KEGG   Sarcophilus harrisii (Tasmanian devil): 100932156Help
Entry
100932156         CDS       T02286                                 

Gene name
PNPLA7
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7 isoform X1
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100932156 (PNPLA7)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100932156 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
1
AA seq 1334 aa AA seqDB search
MAAAMLAAMEKELNKSYTKILSLTTTSYSWIMQLVEYHKHSTMIRGIAIGATLALLFIGI
VIYFVYKRMKWSSQELSVSPQYRFRKRDKMMFYGRKIMRKVSTLPNSLVGYSTVPRQRMR
KRTKVLSLAKRILRFKKDYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVL
GHFEKPLFLELCKHMVFVQLQEGEYIFRPGDLDNSIYVVQDGRLEVCIQENDGTEVVLKE
VLAGDSVHSLLSIVDVITGHAAPYKTVSARAGVPSTILRLPAAAFQGIFEKYPETLVRVV
QIIMVRLQRVTFLALHNYLGLTTELFNSVSQAIPLTSLANVTSNKIKKQMSCPASDEEQK
GEKVEKSQECSECSDHKRESQLETCSLLMKRSFSSPLPSMHGENFDELGKFQGIGPDTQT
PPGSSIGTKSDLGMVYNRARLNLLSDEPPVVSSKSRKSVTLSEIPSAVIHYSEDIEEPGI
SWKTDAIFKAAKKDLLTLMKLDDPSLLDNKVTLLHVPAGTVVSKQGDQDVNIRFVVSGML
HVYQQKIDSEENTCLFITHPGELVGQLSVLTGEPLIFTIKANKECCFLSISKSHFYEIMR
KQPNVVLAVAHTVVKRMSPFVRQMDFALDWMEVEAGRAIYRQGDKSDCTYIVLSGRLRSV
VKKDDGKKRLAGEYGRGDLIGVVETLTYQSRATTVHAVRDSELAKLPAGALTSIKRRYPQ
VVTRLIHLLGEKILGNLQQGSIPGHQFGLYFSGNKWDSGNPSSNLSTVAIMPVSEDVPLI
TFTLELNHALSGIGPVLLLTSDNIKQRLGAAALDSIHEYRLSSWLGQQEDIHRIVLYQAD
STLTPWTQRCIRQADCILIVGLGDQEPTVGELEKMLENTAVRAQKQLILLHKEDGPEPSR
TVEWLNMRTWCSAHLHLRCPRRVFSRRTRAKVMEMYERVFQKSPDLYSDFSRLARVLTGN
AIALVLGGGGARGCSQVGIIRALMEAGIPVDMTGGTSVGSFMGALFAEERNYSQTRIRAK
QWALDMTSVMKTVLDLTYPITSMFSGAAFNNSIRKVFKDKQIEDLWIPYFVITTDITAST
MRVHTDGCLWRYVRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAI
DVGSRDETDLTNYGDSLSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKN
SDYCEYIRPPIDRYGTLDFNRFDEICEVGYQHGRTVFSIWNRSGVLKKMLKDRHEIRKMK
ATDVLTYPNASFTDLAEIVSRIEPARSTVADDESDYQTEYEEEILDFPREDIDYQSTAKQ
DTQKDSSLCEENSD
NT seq 4005 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagccatgctggccgccatggagaaggaattgaataaatcctacacaaagatt
ttgtctttgactactacctcatactcctggattatgcagttggtggaatatcataagcac
tcaaccatgataagaggaattgcaattggagctacattagccctgcttttcatcggcatt
gtcatctactttgtttacaagaggatgaagtggtcttcacaagagctttcagtatctcct
cagtacaggttccgtaaaagagacaaaatgatgttttatggccgaaagatcatgaggaag
gtgagtaccctgccaaacagtcttgttggttacagcactgtgccccggcagagaatgagg
aagagaaccaaagttctgtctttggctaaaaggatcctgcggttcaagaaggactatccc
accttgcagccaaaggagccccctccctccttgttagaagctgatctcactgagtttgat
gttaaaaattctcatctaccatctgaggtcttatacatgctgaaaaatgtccgagtcctg
ggccactttgagaagccactgtttctggaactctgcaaacacatggtttttgtgcagtta
caagaaggagagtacatcttccgtcctggagatcttgacaacagtatttatgtggtacag
gatgggagattggaagtttgcattcaggaaaatgatggtaccgaggtggtgctgaaagag
gtcctggccggagacagtgtccacagcctcctcagcatcgttgatgtcatcactggccat
gcagctccatataaaaccgtctctgccagggcaggggtaccatctactattttaaggctt
ccagctgctgctttccaaggtatctttgagaaataccctgagaccttggtgagggtagta
cagatcataatggtgcggctgcaaagagtgacctttttggctctacataattacctaggg
cttaccactgaactcttcaactctgtaagtcaggctattccattgacgtctctggccaat
gtaacatccaacaaaattaagaagcagatgtcctgtccagcatcagatgaagaacaaaag
ggagagaaggttgagaagtcccaagaatgctcagaatgctcagatcataagagggaaagc
cagttagaaacctgttcgcttcttatgaagcggagcttctccagcccactgccttcaatg
catggagagaattttgatgaactaggaaaattccaagggattggacctgacacacagaca
cctccaggctcttccattggtactaaatcagacttggggatggtatacaacagggccaga
cttaatctcctttcggatgaacctcccgtggtctccagcaagtcaaggaaatcagtaaca
ttgtcagagatcccctctgctgtcatccattactcggaagacattgaggaacctggtatt
agctggaagacggatgctattttcaaagcggccaagaaagatcttctcaccctgatgaaa
ctggatgatccttcactcttggataacaaagtgaccttgcttcatgttcctgcaggtact
gtcgtgtcaaaacaaggagaccaggatgtcaacatccggtttgtggtctctgggatgcta
catgtatatcagcagaagattgacagtgaagaaaatacatgcctatttatcacccatcct
ggggagctggtaggccagctgtctgtacttactggggagccacttatctttaccatcaag
gccaacaaagaatgttgcttcctctccatctccaagtctcatttctatgagattatgcgc
aagcaaccgaatgttgtcctggctgtggctcacacagttgtgaagagaatgtctccattt
gtgagacagatggactttgctctggattggatggaagtagaagctggacgtgcaatttac
aggcagggtgataaatctgactgcacatatattgtactcagtggccgtctgcgctctgta
gtcaagaaagatgatgggaaaaaacgcctggctggtgaatatggacgaggagatctcatt
ggtgtggtggagacactaacctatcagtccagagctacaacagtacatgctgtccgtgat
tcagaattggccaagttaccagcaggagcattgacttccatcaagcgcagatatccacag
gttgtgactaggctgatccatttgcttggggaaaagatccttggcaatcttcagcaggga
tctataccaggtcaccaatttggactgtatttctctggcaacaagtgggattctgggaat
ccatccagtaacctttcaacagtggccatcatgccagtatcagaagatgtgcccctcatt
acatttactctggaactcaatcatgccctcagtgggattggcccagtcttgctattgacc
agtgacaacatcaaacaacgtcttggagctgcagctctggacagtattcatgaatacaga
ttatccagttggctggggcaacaggaagacatccaccgcattgttctctaccaggcagac
agtaccttgaccccttggacccagcgctgtattcggcaggcagactgtatcctgattgtt
gggttgggagaccaagagcccactgtgggcgagctggaaaaaatgctggaaaacacagcc
gttcgtgctcagaagcaattgatcctacttcacaaggaggatgggccagagccttcccgc
acagttgagtggcttaacatgagaacctggtgttcagcccacttgcaccttcgctgcccc
cgtcgggtcttttctcgcaggactcgggccaaagtgatggaaatgtatgaacgtgtcttc
cagaagtctcctgatttgtactctgacttttcccgcctggctcgagttttgactggaaat
gctattgcattagtgcttggaggaggaggagcaagaggttgctcccaagttggtatcatc
cgggccttgatggaggcaggaattcctgtggatatgacaggaggaacctcagttggatct
ttcatgggggctctatttgctgaggagcgaaactacagccagacaaggatccgggccaag
cagtgggccttggatatgacttcagtaatgaagacagtgctggacctgacttatccgatt
acctccatgttctctggagcagctttcaataatagcatcagaaaagtcttcaaagacaaa
cagattgaggacctctggattccttattttgttataacaacagatatcactgcctctaca
atgagggtccacacagacggctgcctgtggaggtatgtccgagccagtatgtctctatct
ggttacatgcccccgctctgtgaccccaaagatgggcacctactgatggatggtggctat
atcaacaacctcccagctgacgtggccagatctatgggtgccaaagtggtgattgccatt
gacgtgggcagcagggatgaaacggacctcaccaactacggtgactcgctgtctggctgg
tggctgctgtggaaacgctggaaccctctggctacaaaagtgaaggtgctgaatatggca
gagatccagacacgtttggcctatgtgtgctgtgtcaggcaactggagatggtgaagaac
agtgattactgtgaatatatccgaccacccattgatcgctatggcaccctggacttcaac
agatttgatgaaatctgtgaggtgggttaccagcatggacgaactgtatttagcatctgg
aaccgcagtggtgtgctgaaaaagatgctaaaggaccgacacgaaatccgcaaaatgaaa
gccacagatgtgctcacctaccccaatgcctccttcactgacctggcagagattgtgtca
cgtattgaaccagcccgatccacagtggctgatgatgaatccgactaccagactgaatat
gaagaggagatcctagacttccctagggaggatatcgactaccagagtactgcaaaacaa
gatactcagaaagattcttccttgtgtgaagagaattcagactag

DBGET integrated database retrieval system