KEGG   Sarcophilus harrisii (Tasmanian devil): 100932183Help
Entry
100932183         CDS       T02286                                 

Gene name
ST6GAL2
Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 2 isoform X1
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00510  N-Glycan biosynthesis
shr00514  Other types of O-glycan biosynthesis
shr01100  Metabolic pathways
Module
shr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100932183 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    100932183 (ST6GAL2)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     100932183 (ST6GAL2)
Glycosyltransferases [BR:shr01003]
 Terminal extension
  Sialyltransferase
   100932183 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 100932183
NCBI-ProteinID: XP_003765737
Ensembl: ENSSHAG00000013611
Position
3
AA seq 541 aa AA seqDB search
MTQHPTLLSRLSASGHRSVDTDSAMKPNLKQWKQLMLFGIFAWGLLFLVIFIYFTDSNTV
EPVPSSFSFVETKRILPIQGKQRSIMGAMHDPSFSETIDGNEVLLNGNLFDSFNLGSNSF
QKWTEIKNGFENEELFPSQMRKKSPRLFYQVDDDYFFTMGQPMSHSPNQQMVKFMPLSEE
DQQGSIRQNRKKIISRHRRSQLPHWDRLYSTMSKSFLYRLWKGNVSSKMLNPRLQKAMKD
YLTTNKHRVRFRGKRNSKLTREQLLCKLRDQVTVKTLDGKEAPFSDLGWEKYVPRVPLSK
LYPQGLGSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTHGYERDVGNKTTMRIINSQ
ILTNPNHHFIESSLYKDVILVAWDPAPYSANLHLWYKKPDYNLFTPYIQHRRKNPNQPFY
ILHPKFIWQLWDIIQENTKEKIQPNPPSSGFIGILIMMSLCREVHVYEYIPSVRQTDLCH
YHELYYDAACTLGAYHPLLYEKLLVQRINKGIRDDLYRKGKAILPGFRAISCPESDQFPN
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcatccaaccctactctccaggttgtctgcttcaggacacagaagtgttgat
acggactctgccatgaaaccgaacttgaaacaatggaaacaactaatgctctttgggata
tttgcttggggtctcctgtttttagtcatcttcatctatttcacagatagcaacactgtg
gaaccagttccaagttctttctcatttgttgaaactaaaaggatcctgcctatccaaggg
aaacagagatcaattatgggtgccatgcatgacccatccttttctgaaaccattgatggg
aatgaagtgcttctcaatggaaacctttttgattcatttaatttaggttccaatagcttt
cagaaatggactgaaataaaaaatggttttgagaatgaagagctttttccttctcagatg
agaaaaaaatccccacgccttttctatcaagtagacgatgactatttttttactatgggc
caacctatgtcacacagccccaaccagcagatggtgaagttcatgcctcttagtgaggag
gaccagcaagggagcatcagacaaaatcgaaagaaaattatctccaggcacaggagaagc
caattgcctcactgggacagactctattccaccatgtccaagtcctttctgtaccggctt
tggaaaggaaatgtctcttcaaaaatgctaaatccacgtttacaaaaagcaatgaaagat
tatctcactaccaacaagcacagagtgaggtttaggggaaaaaggaactccaagctgaca
agagaacagctactgtgtaaactcagggatcaagtgactgtgaagaccctggatggaaag
gaggcccccttttcagaccttggctgggagaagtatgtccctcgggtgcccctgagcaaa
ctctatcctcaaggtttggggagctgtgcggtagtcatgtctgcaggtgcaatcctgaac
tcctcactgggggaagaaatagattctcatgatgcagttttgaggtttaattctgctcct
acacatggttatgaaagagatgttggaaataaaacaaccatgcgcatcattaattcccag
attctgaccaatccaaaccatcactttattgagagttcattatataaggatgtcatttta
gtggcttgggaccctgctccttactccgcaaatcttcacttgtggtataagaagccagat
tataatctcttcactccttatattcagcatcgtagaaagaacccaaatcaacctttttat
attcttcatcctaaatttatttggcaactctgggacataatccaagagaacactaaagag
aagattcagccaaatcccccatcttctggtttcataggaatacttatcatgatgtcgctg
tgcagagaagtgcacgtgtatgaatacattccatctgtacgacaaactgacctctgccac
tatcatgaactatactatgatgcagcctgcactctgggggcctatcatcccctgctctat
gagaagctcctggtgcagaggataaacaaaggcatccgggatgatctgtaccgaaagggg
aaagcaatcctgccaggatttcgggctatcagctgtcctgaatctgatcaatttccgaat
ccttaa

DBGET integrated database retrieval system