KEGG   Sarcophilus harrisii (Tasmanian devil): 100932216Help
Entry
100932216         CDS       T02286                                 

Gene name
KAT5
Definition
(RefSeq) K(lysine) acetyltransferase 5
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100932216 (KAT5)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100932216 (KAT5)
Chromosome [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100932216 (KAT5)
   HAT complexes
    TIP60 complex
     100932216 (KAT5)
    NuA4 complex
     100932216 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 582 aa AA seqDB search
MRGRIRTKGAIDRTGAALGKAGLRVPSEQQQPHHVVACDHVTPTRANDVTWTGAGGGQIP
SPLPRVPASAPSSLAALAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHDRLDLKKIQFP
KKEAKTPTKNGLPGSRPGSPEREVRKTLDLSLQPASAQASGKTLPIPVQITLRFNLPKER
EAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQVGAWLPSRAA
GSPAPPEPGAAGPRAGRRAHLPNRPQDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKN
IECIELGRHRLKPWYFSPYPQELTALPVLYLCEFCLKYGKSLKCLQRHLTKCDLRHPPGN
EIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHI
VGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGL
LSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQ
YILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcaggattcgaaccaagggcgcgattgacagaacaggggcggcgctcggcaag
gcggggctccgggttccatcagaacaacaacaaccgcatcacgtggtcgcgtgcgaccac
gtgaccccgacgcgcgcgaacgacgtcacgtggactggagctggaggaggccagattccg
tcccccttgcccagggtcccagcgtcagccccctcctcccttgcagctttggcagagatc
ctgagcgtgaaggacatcagcggccggaagctcttctatgttcactacatcgacttcaac
aagcgcctggatgagtgggtgacccatgacaggctggacctaaagaagatccagtttcct
aagaaagaggccaagacccccacaaaaaatgggctccctgggtccagaccgggctcccct
gagcgggaggtgaggaagaccctggacctatctctacagccggcttcggcccaggccagt
gggaagacactgccgatcccagtgcagatcacgctccgcttcaacctacccaaggagcga
gaggccatccccggcggcgagcctgaccagcccctctcctccagctcctgcctgcagccc
aaccaccgttccacgaaacgaaaagtggaagtggtttcaccggcgactcccgtacccagc
gagaccgcgccggcctccgtgtttcctcaggtgggtgcttggctcccctcccgcgccgcc
gggtcccccgcccccccggagcccggggcggccggcccccgggcgggccgacgcgctcac
cttcccaaccgcccccaggactcccaggacagctcggacgggatcccgtcggccccccgc
atgaccggcagcttggtgtccgaccggagccacgacgacatcgtcacccgcatgaagaac
atcgagtgcatcgagctgggccgccaccgcctcaagccctggtacttctccccgtacccc
caggagctgaccgccctgcccgtgctctacctctgtgaattctgcctcaagtacggcaag
agcctcaagtgtctgcagcggcacctgaccaaatgtgacctgagacaccccccgggcaat
gagatttaccgaaagggcaccatctccttcttcgagattgacgggcgcaagaacaagagt
tactcccagaacctctgccttctggccaagtgtttcctggaccacaagaccctgtactac
gacaccgaccccttcctcttctacgtcatgaccgagtacgactgcaagggcttccacatc
gtcggctacttctccaaggagaaagaatccacggaggactacaacgtggcctgcatcctg
accctgcccccgtaccagcgccgcggctacggcaagctgctcatcgagttcagctatgag
ctttccaaggtggaagggaagacgggcacgcccgagaagccactctcggaccttggcctc
ctgtcctaccggagctactggtcacagaccatcctggagatcctcatgggactcaagtcg
gagagcggggagcggccccagatcaccattaatgagatcagcgagatcaccagcatcaag
aaggaagacgtcatctcgaccctgcagtacctgaacctcatcaactactacaagggccag
tacatcctgacgctgtcagaggacattgtggacgggcacgagcgggccatgctgaagcgg
ctcctgcgcatcgactccaagtgtctgcacttcacccccaaggactggagtaaacgggga
aagtggtga

DBGET integrated database retrieval system