KEGG   Sarcophilus harrisii (Tasmanian devil): 100932226Help
Entry
100932226         CDS       T02286                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100932226 (GCH1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100932226 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 276 aa AA seqDB search
MEGVPTSPRTERPQLRASVPLLPSKQMDKANTARTAVEKKRGAQCNGYSAKEQSRAERNE
LEKKPRGQEEKTAQQVDSWKTERTRSVEDNELNLPSLAGAYSTILRSLGEDPERQGLLKT
PWRAATAMQFFTKGYQETIADILNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHI
GYLPNKQLLGLSKLARIVEIYSRRLQVQERLTKQIAVAVTEALRPAGVGVVVEATHMCMV
MRGVQKMNSKTVTSTMLGVFREDPKTREEFLALIKN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagtcccaacttcccctagaactgaacgcccgcagctgcgggcttcagttcct
cttctgccctccaagcagatggataaggccaatactgctcgcacagcagtggagaagaag
cggggtgcccaatgcaatgggtattctgcgaaggaacaatcccgggcagagcggaatgaa
ctagagaaaaagccccggggccaggaggaaaagactgcccagcaggtggactcttggaag
acggagcggactcgcagcgtggaggacaacgagctgaacctgcccagtctggcgggcgct
tactccaccattctgcgctccctgggtgaggacccggaacggcagggactgctcaagacc
ccctggagggcggcaacagccatgcagttcttcactaagggttaccaggagaccattgca
gatatcctgaatgacgctatatttgatgaagaccatgatgagatggtgattgtaaaggac
atagacatgttttcaatgtgtgaacatcacttagtgccatttgttggaaaggttcatata
ggttatcttcctaacaaacaacttcttggcctcagtaaacttgcaaggattgtggaaatc
tatagtagaagattacaagttcaagagagacttacaaaacaaattgcggtagcagtcaca
gaagccctgcggccagctggagttggcgtggttgttgaagcaacacatatgtgtatggta
atgagaggggtacagaaaatgaacagcaaaactgtcaccagcacaatgttgggcgtattc
cgggaagatccaaagacccgggaagaattcttagcgctcattaagaattga

DBGET integrated database retrieval system