KEGG   Sarcophilus harrisii (Tasmanian devil): 100932272Help
Entry
100932272         CDS       T02286                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100932272 (UCHL5)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100932272 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 489 aa AA seqDB search
MGRTATPPPSPSVYKQVLKSKPAHKLHFAFGDLFNPRGGSSSVSPASSAGKTSLVQRPAR
PWDAKGRAPAPCEPEPTSLAEAAPFRLPGETAFGTDSEPRRGPALFFLLFLLLVMRGLVA
RLVSWEKVIFLSLQKENRKKKSPPDPGGKQSTLKPRVCLHHLSDRALGLRRVRLLAADSS
RAKWGCCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFA
KQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSEVIRQVH
NSFARQQMFEFDAKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQEDWINAV
RPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQSSNMLSTI
QSEVAKHQMLIEEEIQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQ
NAKKAQETK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggggcggaccgctacaccgcctccctcgccctccgtttataaacaagtccttaaatca
aaacccgctcacaaactgcatttcgccttcggggatctctttaatccgcgcggcggcagc
agcagcgtctcccccgccagcagcgcaggcaaaacgagcctagtacagcgacccgctcgc
ccgtgggacgccaagggaagggcccccgccccgtgcgagcccgagccgactagcctggct
gaagctgccccctttagacttcctggggaaactgcctttgggaccgactcggagccccgc
agaggccccgccctctttttcctcctcttcctcctgcttgtgatgcgaggcctcgtggct
cgcttggtttcctgggagaaagtgatctttctgtccctgcaaaaagaaaacaggaaaaaa
aaatccccccctgatcccggcggaaagcaatcaactcttaagcctcgtgtttgccttcat
cacctctcggatagagccctcggacttagacgagtacgtctgctcgccgcagattcctca
cgtgcaaagtggggctgttgtcgaggagcacaagtagaagaaatatggagtttggagcca
gagaactttgagaaattaaagccagttcatgggttaatttttcttttcaagtggcagcca
ggagaagaaccagcaggctctgtggttcaggattccagacttgatacaatattttttgca
aagcaggtaataaataatgcttgtgcaactcaagccatagtcagtgtattattgaattgt
actcaccaagatgtccatctaggggaaacactttcagagtttaaagaattttcacaaagt
tttgatgctgctatgaaaggattggcattaagcaactcagaagtgattcgacaagttcac
aacagttttgccagacaacaaatgtttgaatttgatgcaaaaacatcagcaaaagaggaa
gatgcttttcattttgttagttatgttcctgtcaatggaagactatatgaattagatgga
ttaagagaaggaccaattgatttaggtgcatgtaatcaagaagattggattaatgcagta
aggccagttatagagaaaagaattcaaaaatacagtgaaggtgaaatacgatttaatctg
atggccattgtgtctgacagaaaaatgatatatgaacagaagatagcggagttgcaaaga
cagcttgcagaggaggaaccgatggatacagatcagagtagtaatatgttaagtaccatt
cagtcagaagttgccaaacatcagatgctaattgaagaagaaattcagaaattaaaaaga
tacaagattgaaaatattagaagaaagcataattatctgcctttcatcatggagctatta
aagactttagcagaacaccagcagttaataccattagtagaaaaggcaaaagaaaaacag
aatgcgaagaaagctcaggaaaccaaataa

DBGET integrated database retrieval system