KEGG   Sarcophilus harrisii (Tasmanian devil): 100932348Help
Entry
100932348         CDS       T02286                                 

Gene name
HIBCH
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100932348 (HIBCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100932348 (HIBCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100932348 (HIBCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100932348 (HIBCH)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100932348 (HIBCH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 386 aa AA seqDB search
MGLSEVLRPMSRFNSFKRTQVILQHLGMSKHTDSEPEVFLERTGCAGVITLNRPKVLNSL
NLSMIRRIYSQLKKWEQEPETSLIIIKGAGGKAFCAGGDIKAISEAGKAKQKLAQDFFKE
EYTLNSAIGTCKKPFVSLIHGVTMGGGVGLSVHGHFRVATEKTLFAMPETAIGLFPDVGG
GYFLPRLSGKLGYFLALTGFRLKGRDVQKGGIATHFVDSDKLPMLEKDLLALKSPSKENV
AEVLDTYHKKCKVDQDKPFILEEHMDRINSCFSASTVEQIIQNLQEDGSPFALEQLKVFE
KMSPTSLKITLRQIMEGSSKSLQEVLIMEYRLSQACLRGHDFYEGVRAVLIEKDQNPKWK
PAKLEEITDEFLNDCFKSLGSDDLKF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggggctttccgaggtgctcaggcctatgtccaggttcaattctttcaagaggacacag
gttatactgcaacatttaggaatgtctaagcacacagactcagaaccagaagtgttcttg
gaaagaacaggttgtgcaggagtaataacattaaacagaccaaaggttctgaactcattg
aatctgtccatgatacgacggatttattcacagttaaagaagtgggaacaagaaccagaa
acttctttgattatcataaaaggagctggaggaaaggctttctgtgctggaggtgatatc
aaagccatatcagaagcagggaaggcaaaacagaaattggctcaagacttctttaaagaa
gaatatactttgaactctgccattggtacttgtaagaagccttttgtttcacttattcat
ggagttacaatgggtggaggtgttggtctctcagttcatgggcatttccgagtagctaca
gagaaaacgctttttgctatgccagaaacagcaataggacttttccctgatgtgggtgga
ggttattttctaccacgcctttcaggaaaacttggttacttcctggcactcacaggattc
agattgaaaggtagagatgtgcaaaaaggaggaattgctacgcactttgtagactctgac
aagttgcctatgctggagaaagatttgttggccctgaaatctccttcaaaagaaaacgtg
gcagaagtcttggatacttaccacaaaaagtgtaaagttgatcaagataaacctttcata
cttgaggaacatatggacagaattaacagttgtttttcagcaagtactgtggaacagatt
attcagaatttacaagaagatggttcaccttttgcacttgaacaattgaaggtgtttgaa
aaaatgtctccaacctccttaaagatcacattaagacagataatggaaggttcttcaaag
agcttacaagaagtgttaattatggaatataggctgagtcaagcatgcttgagaggccat
gacttttatgaaggtgttcgagcagttttgattgaaaaagaccagaaccctaagtggaag
ccagccaaattagaagaaataactgatgaatttctgaatgactgctttaagtcattggga
agtgatgatctcaaattttaa

DBGET integrated database retrieval system