KEGG   Sarcophilus harrisii (Tasmanian devil): 100932451Help
Entry
100932451         CDS       T02286                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:shr00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 481 aa AA seqDB search
MLLSVVLLLVLLAALRWLWMELTVSPHHFPPLVPGFLHFIHSDFPSHFLSLAQKYGPLYR
LHLGMQEVVVLNSKKAIEEAFMKKWIDFSGRPQTFTIQLVSNDSQDLSLGDYTPLWKAHR
KLARSALLYVQNSMEPLVGQMVQDLCKKLLAQAGSPVSISEEFSMFTCSIICFLSFGEKR
KSSVQEINSCIEELMIAWDCWQVQILNFLPFLRFFPNPGLRKLRQIIKKRDGIVQKQLRW
HKETMVEGQTRDLTDYMLQKLREQGEGQGQLSEGHVHMALVDFFIGGTETTASTLTWAVA
FLLHHPEIQRRLQEELDQELGPGFSGSPPNYQDRARFPLLNATITEVLRLRPAAPLALPH
CTKQPSSICGFDIPKDTIIIPNIFGAHHDDSVWAQPYDFRPDRFLEPELSPSGIPFSCGA
RVCLGEALARLELFLILAHLLQAFTLLPVIEGSHNLPSLKPTFGSNIKAQDFQVRLLPRL
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgctgctttctgtggtcctgctgctggttctgctagctgccctaaggtggctatggatg
gaactgactgtctcaccccatcacttcccacctctagtccctggttttcttcacttcatc
cactctgatttcccaagccattttttgagccttgcacagaaatatgggccactctatcgg
cttcaccttgggatgcaagaagtggtggtgctaaattccaagaaggcaattgaggaggct
ttcatgaagaaatggatcgatttttcagggagaccacaaacattcactattcaattggta
agcaacgacagccaggatctgtctctgggggattacacgccactctggaaggcccacagg
aaactggcccgttctgctcttctgtatgtccagaatagcatggagcctctcgtgggacag
atggtacaagacttgtgtaagaagctccttgcccaggctggctctcctgtgagcatatct
gaggagttttccatgttcacttgtagcatcatctgcttcctcagttttggagaaaagaga
aagtcttcagttcaggaaattaacagctgcattgaggaattgatgatagcctgggactgt
tggcaagtccagattttgaacttcctaccctttctcaggtttttccccaacccaggtctc
aggaagctgaggcagataataaagaaacgggatgggattgtgcaaaagcaactgagatgg
cacaaggagacaatggtggaaggacagactcgggatttgactgattatatgctacagaaa
ctcagggaacaaggagaagggcaaggtcagctttctgagggacatgtacacatggcttta
gtggacttcttcattggaggcacagagaccacagcatccaccctcacctgggcagtggcc
ttcctgcttcatcacccagagatacaaaggcggctgcaagaagagttggatcaagagctg
ggaccaggtttttcaggaagccctcccaactatcaagacagagctcggttccccctgctc
aatgctacaattaccgaggtactccggctaagacctgcagcccccttggcccttccacac
tgcaccaaacagcctagcagcatatgtggttttgacatccctaaggataccattattatc
cccaacatctttggtgctcaccatgatgacagtgtttgggcacagccatatgacttccgg
cctgatcgtttcttggagccagaactgagtccgtcagggatcccattcagctgtggggcc
agggtgtgcttgggagaggctctggctcgcttagagctcttcttgatcctggctcacctg
ctccaagctttcacactactgcctgtaattgagggcagccataatctgccttctctgaag
cccacttttggaagcaatataaaggcccaagactttcaagtgcggctgctgcctcggctg
gaatga

DBGET integrated database retrieval system