KEGG   Sarcophilus harrisii (Tasmanian devil): 100932477Help
Entry
100932477         CDS       T02286                                 

Definition
(RefSeq) HRAS-like suppressor 3
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00564  Glycerophospholipid metabolism
shr00565  Ether lipid metabolism
shr00590  Arachidonic acid metabolism
shr00591  Linoleic acid metabolism
shr00592  alpha-Linolenic acid metabolism
shr01100  Metabolic pathways
shr04014  Ras signaling pathway
shr04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100932477
   00565 Ether lipid metabolism
    100932477
   00590 Arachidonic acid metabolism
    100932477
   00591 Linoleic acid metabolism
    100932477
   00592 alpha-Linolenic acid metabolism
    100932477
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100932477
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100932477
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100932477
    3.1.1.32  phospholipase A1
     100932477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT NLPC_P60 NACHT_N
Motif
Other DBs
NCBI-GeneID: 100932477
NCBI-ProteinID: XP_012408520
Ensembl: ENSSHAG00000003229
Position
6
AA seq 159 aa AA seqDB search
MQPEPKPGDLIEIFRWGYRHWAVYVGDGFVVHLAPPSEYAGAGASSVMSALTDKATVKKE
LLSEVVGRDRYRVNNKHDDKYPPLPPGKIVQRALQEVGKDVLYKLSSENCEHFVNELRYG
IPRSDQVTDAITAVGVASLAIAGVSLISYIVSRNRRQNQ
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagagcccaaacctggagacctgattgagattttccgatggggctaccgtcat
tgggctgtctatgtgggggatggctttgtcgtccacctagcacctccaagtgaatatgct
ggggctggtgcatccagcgtcatgtcggccctgacggacaaagccacggtcaagaaggag
ttgctgagtgaagtggtcgggagggacaggtaccgggtgaacaacaaacatgatgacaag
tacccaccactgccccccggcaagattgtccagagggccttgcaggaggtggggaaggat
gtcctctacaaactgagcagtgagaactgtgagcactttgtgaatgaactgagatacgga
atccctcgcagtgaccaggtcacagatgccatcacggccgtcggagtagccagtttagcc
attgccggcgtcagcctcattagctacatagtgtcaagaaacagacggcaaaaccaataa

DBGET integrated database retrieval system