KEGG   Sarcophilus harrisii (Tasmanian devil): 100932477Help
Entry
100932477         CDS       T02286                                 

Gene name
PLA2G16
Definition
phospholipase A2, group XVI
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100932477 (PLA2G16)
   00565 Ether lipid metabolism
    100932477 (PLA2G16)
   00590 Arachidonic acid metabolism
    100932477 (PLA2G16)
   00591 Linoleic acid metabolism
    100932477 (PLA2G16)
   00592 alpha-Linolenic acid metabolism
    100932477 (PLA2G16)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100932477 (PLA2G16)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100932477 (PLA2G16)
    3.1.1.32  phospholipase A1
     100932477 (PLA2G16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 162 aa AA seqDB search
MRAPGPEPKPGDLIEIFRWGYRHWAVYVGDGFVVHLAPPSEYAGAGASSVMSALTDKATV
KKELLSEVVGRDRYRVNNKHDDKYPPLPPGKIVQRALQEVGKDVLYKLSSENCEHFVNEL
RYGIPRSDQVTDAITAVGVASLAIAGVSLISYIVSRNRRQNQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagagctccagggccagagcccaaacctggagacctgattgagattttccgatggggc
taccgtcattgggctgtctatgtgggggatggctttgtcgtccacctagcacctccaagt
gaatatgctggggctggtgcatccagcgtcatgtcggccctgacggacaaagccacggtc
aagaaggagttgctgagtgaagtggtcgggagggacaggtaccgggtgaacaacaaacat
gatgacaagtacccaccactgccccccggcaagattgtccagagggccttgcaggaggtg
gggaaggatgtcctctacaaactgagcagtgagaactgtgagcactttgtgaatgaactg
agatacggaatccctcgcagtgaccaggtcacagatgccatcacggccgtcggagtagcc
agtttagccattgccggcgtcagcctcattagctacatagtgtcaagaaacagacggcaa
aaccaataa

DBGET integrated database retrieval system