KEGG   Sarcophilus harrisii (Tasmanian devil): 100932628Help
Entry
100932628         CDS       T02286                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     100932628
Peptidases [BR:shr01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100932628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 382 aa AA seqDB search
MRCLLVFLAIIALSDCMIRLPLMKGNTLRHKLKKHGLLADFLEENKYSLSSKYRRYGEAA
KVASEPLTNFLDSQYFGKIYIGTPPQEFTVVFDTGSSNLWVPSVYCNSTACENHHRFSPS
ESSTFNSTEEPLSIQYGTGSMEGVLGYDTVIVSSIVDPDQIFGLSTQEPGNIFTYSEFDG
ILGLGYPSLAVDQATPVFDNMMNKHLVAQNLFSVYMNRHGPGSMLTLGAIDSSYYTGSLH
WVPITVQGYWQFSVDRITVNGQVVACDGGCQAILDTGTSLLVGPSYDISNIQSVIGATQG
QYGEFDIDCSSLSSMPTVVIHINGRQYPLPPSAYTIQMESVCTSGFQGDGSSQLWILGDV
FIREYYSVFDRANNRVGLAKAV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtcttctggtcttccttgccatcatagccctctctgactgcatgataagattg
ccactcatgaaagggaatacgttaagacataagctgaaaaagcatggtttgctggcagac
tttctggaggagaacaagtattccctcagctccaagtaccgacgctacggtgaagctgcc
aaggttgcgagtgaacccttgacgaatttcctggattctcaatactttggaaagatttac
attggaactccaccccaagagttcactgtggtgttcgacaccggttcctctaatctctgg
gtcccctcagtctactgcaacagtactgcctgcgaaaaccaccatagattctccccctct
gagtcctccaccttcaacagcaccgaagaacctctgtccatccagtatggtactggcagc
atggagggagtcctgggctatgacactgtcattgtctccagtattgtggaccctgaccag
atctttggcctgagcacccaggagcctggaaacatctttacctattctgaatttgatggg
atcctaggactgggctacccttccctggctgtggatcaggccacccctgtctttgacaac
atgatgaataagcacttggttgcccagaacctcttctctgtttatatgaacagacacggc
ccaggcagcatgctcacccttggggccatcgattcatcctactacactggctctctccac
tgggtgcccatcaccgtgcagggctactggcagttctctgtggacagaatcactgtcaat
ggccaggtggtggcttgtgatggtggttgccaggccatcttggacaccggtacctctctt
ttggtcggtccaagctatgacatcagcaacatccagagtgtcattggagctacccagggc
caatatggagagtttgacatcgattgcagcagcctgagctccatgcctacagttgtgatt
cacatcaatggcagacagtaccctctccctccctcagcctacactatccagatggaaagt
gtgtgtaccagtggcttccagggtgatggtagttcccagctatggatcttgggagacgtc
ttcattcgagaatactacagcgtctttgacagggctaacaaccgtgtggggctggccaaa
gcagtctaa

DBGET integrated database retrieval system