KEGG   Sarcophilus harrisii (Tasmanian devil): 100932634Help
Entry
100932634         CDS       T02286                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Purine metabolism
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Phospholipase D signaling pathway
Oocyte meiosis
Longevity regulating pathway - mammal
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Pathways in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100932634 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100932634 (ADCY6)
   04072 Phospholipase D signaling pathway
    100932634 (ADCY6)
   04024 cAMP signaling pathway
    100932634 (ADCY6)
   04022 cGMP - PKG signaling pathway
    100932634 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100932634 (ADCY6)
  Cellular commiunity
   04540 Gap junction
    100932634 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100932634 (ADCY6)
   04062 Chemokine signaling pathway
    100932634 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    100932634 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    100932634 (ADCY6)
   04912 GnRH signaling pathway
    100932634 (ADCY6)
   04913 Ovarian Steroidogenesis
    100932634 (ADCY6)
   04915 Estrogen signaling pathway
    100932634 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    100932634 (ADCY6)
   04921 Oxytocin signaling pathway
    100932634 (ADCY6)
   04918 Thyroid hormone synthesis
    100932634 (ADCY6)
   04916 Melanogenesis
    100932634 (ADCY6)
   04924 Renin secretion
    100932634 (ADCY6)
   04925 Aldosterone synthesis and secretion
    100932634 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100932634 (ADCY6)
   04270 Vascular smooth muscle contraction
    100932634 (ADCY6)
  Digestive system
   04970 Salivary secretion
    100932634 (ADCY6)
   04971 Gastric acid secretion
    100932634 (ADCY6)
   04972 Pancreatic secretion
    100932634 (ADCY6)
   04976 Bile secretion
    100932634 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100932634 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100932634 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    100932634 (ADCY6)
   04727 GABAergic synapse
    100932634 (ADCY6)
   04725 Cholinergic synapse
    100932634 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    100932634 (ADCY6)
  Sensory system
   04742 Taste transduction
    100932634 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    100932634 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    100932634 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    100932634 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    100932634 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100932634 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    100932634 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100932634 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    100932634 (ADCY6)
Enzymes [BR:shr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100932634 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1158 aa AA seqDB search
MSWFSGVLVPKVDERKMAWGERNGQKRPHRGSRGSGFCGAHYMSCLQDAEPPSPTLPAPP
RCLWQDDAYSPKGGQIGGKELGLRSVALDLEDNETATLSGMPGSASSCWQHLARVFQSKQ
FRSAKLERLYQRYFFQMNQSSLTLLMGVLVLLTAVLLAFHAAPAHPHPAYVALLAGAAAL
FVALMVVCNRPGFHQDSMWVVSYVVLAVLAAVQVGMALVASPQSASAGLWCPVFFVYITY
TLLPVRMRAAVLNGLGLSVLHLLVTWQLNKGDTFLWKQLSANVLLFLCTNIIGICTHYPA
EVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVALEMKEDINTKKEDMMFHKI
YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCY
YCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKW
QFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQQIETF
LILGASQKRKEEKAMLAKLQRTRANSNEGLMPRWVPDRSFSRTKDSKAFRQMGIDDSSKD
NRGAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQTPELEKKYSRKVDARFG
GYVACMLLVFCFVCFIQLFVVPHSVLMLGLYISIFLLLTVTVLVCAIYSCGTLFPKFLQH
LSRSIVCSRAHSTAVGIFSVLLVFIAAIANMFTCNHTPIRICAARMLNLTPTDITACHLQ
HLNYSLGSDVPLCEGTTPTCSFPEYFNGSLLLSLLAGSVFLHISSIGKLLLTLVLGLLYL
ALLLLGPPAAVFDNYDLLLRAHALSLANETLYGPDCTAGEKVALKYMTPVILLVFALALY
LHAQQVESTARLDFLWKLQATGEKEDMEKLQAYNRRLLHNILPKDVAAHFLARERRNDEL
YYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEQFRQLEKI
KTIGSTYMAASGLNAATYDRVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNIG
PVVAGVIGARKPQYDIWGNTVNVSSRMDSTGIPDRIQVTTDLYQVLAAKGYQLECRGVVK
VKGKGEMTTYFLNGGPNS
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtttagtggtgtcctggtgccaaaggtagatgagcggaagatggcatggggt
gaacgaaatggacagaagcgcccacaccgaggaagcaggggcagtggcttttgtggtgcc
cactacatgagctgcctccaggatgctgagccaccaagccccactcttccagcccctcca
cggtgtctgtggcaggatgatgcctattccccaaaggggggccaaattggagggaaggaa
ctagggctgaggagtgtggccctggacttggaggacaatgagacagcaacactcagtggg
atgcctggaagtgcaagttcttgttggcaacatctggcaagagtgtttcaatcaaaacag
tttcgatcagctaaactggaacggctctaccaacgctatttcttccaaatgaaccagagt
agcttgaccttgctaatgggggtgctggtgctattgacagctgtccttctggctttccac
gctgcccctgctcaccctcaccctgcctatgtggcactcctggctggggctgctgctctc
tttgtggccttgatggtggtatgtaaccgtcctggatttcaccaggattccatgtgggtg
gtgagctacgtagtgctggctgttctggctgctgtgcaggtgggcatggctttggtggct
tctcctcaaagtgcctcagctgggctgtggtgcccggtgttctttgtttacatcacttat
accctgttacctgtccgaatgagggcagctgtgctgaatggcctgggactctcagttctc
cacctgcttgtcacctggcagctcaacaaaggtgacaccttcctctggaagcagctcagt
gccaacgtgctcctgttcctctgtaccaatatcattggcatatgcacgcactatccagct
gaagtgtctcaacgtcaggccttccaggagactcgaggctacatccaggcccggctacac
cttcagcatgagaaccggcagcaggagcgactactgctctcagtcttgccccagcatgtt
gccttggagatgaaagaggacataaacaccaagaaagaggacatgatgtttcataagatc
tatatccagaagcatgataatgtcagcatcctgtttgctgacatcgagggcttcaccagc
ctggcctcccagtgtactgcacaggaattggtcatgacccttaatgagctcttcgcccga
tttgataaactagctgcggaaaatcactgcctacggatcaagatcttgggggactgttac
tattgtgtctctggattaccagaggcccgtgctgaccatgcccactgctgcgtggaaatg
ggtgtggacatgatcgaggctatctcgttggtgcgggaggtcacaggtgtgaatgtgaat
atgcgtgtgggtatccacagtggtcgtgtacactgtggtgttctaggccttcggaaatgg
cagtttgatgtctggtccaatgatgttaccttggcaaatcacatggaggctggaggccgg
gcaggccggatccacattaccagggctactctgcaatatctaaatggtgactatgaagta
gagcctggcaggggtggtgagcggaacgcctatctcaaagagcagcagattgagaccttc
ctgattctgggggccagtcaaaaacggaaggaggaaaaagccatgttggcaaagctacaa
cggactcgagctaactccaatgagggactgatgccacgttgggtgccagatcgttccttt
tctcgaaccaaggactctaaggctttccgccagatgggcatcgatgattcaagtaaagac
aatcgtggtgcccaggaagccctgaacccagaggatgaggtggatgaattcctgggtcgt
gccattgatgcccgaagtattgatcagttgcgcaaagaccatgtacgtcgattccttctc
acctttcagacgccagaacttgaaaagaagtattcccggaaggtggatgcccgttttggg
ggttatgtggcctgcatgctgctagtcttctgtttcgtctgcttcatccagctttttgtc
gtcccacattcagtactgatgcttggactctatatcagcatcttcctgctgctgacagtt
acagtcctagtttgtgcaatctactcctgtggcactctattcccaaagttcctgcagcac
ctctcccgtagcatcgtttgttcacgggcccacagcacagcagttggcatcttttctgtc
ttacttgtcttcatcgctgccatcgccaacatgtttacctgtaaccatactcctatacgg
atctgtgcggctcgaatgctgaacctgacacctacagacatcactgcctgtcacctgcag
catctcaactactcacttggctcggatgtccctctctgtgagggtactacacctacctgc
agctttccagagtatttcaatgggagtctgctgttgagtctcctagctggctctgtcttc
ctgcacataagcagcattggcaagctgctattgacacttgttctgggactgctatatctg
gcattgcttcttctggggcccccagctgctgtctttgacaactatgacctgctgcttcgg
gctcatgcactgtcacttgccaatgaaactctgtatgggccagactgtactgcaggtgag
aaagtggcactgaagtatatgacacctgtcatcctgttagtgtttgcattagcactctac
ttgcatgcccaacaagtggaatcaactgctcgactggactttctgtggaaattgcaggca
acaggggagaaagaagatatggaaaaactccaggcctataaccgacggttactacacaac
atcctacccaaggatgtggcggcacatttcctagcccgagaacggcgtaatgatgaactt
tactatcagtcttgtgaatgtgtggctgtcatgtttgcctccattgcaaacttctctgaa
ttctatgtggagttggaagccaataatgaaggcgttgaatgcctacgactgctcaatgag
attattgctgactttgatgagatcatcagtgaagaacagttcaggcagctggaaaagatt
aaaacaattggcagcacctatatggcagcctcaggattgaatgcagccacatatgatcgg
gtggggcgttcccatatcactgcacttgctgactatgccatgcggctcatggaacagatg
aagcacatcaatgaacactccttcaataacttccagatgaaaattgggctgaacattggc
ccagtagtggcaggcgtcattggggcaagaaagccacagtatgatatctggggcaataca
gtgaatgtgtcgagccgtatggacagcacaggaatccctgaccgaatccaagtgaccact
gacctgtaccaggttctagctgccaagggctaccagttggagtgtcgaggggtggtcaag
gtgaagggtaagggggagatgaccacctacttcctcaatggtggccccaacagttag

DBGET integrated database retrieval system