KEGG   Sarcophilus harrisii (Tasmanian devil): 100932634Help
Entry
100932634         CDS       T02286                                 

Definition
adenylate cyclase type 6-like
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Purine metabolism
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100932634
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100932634
   04024 cAMP signaling pathway
    100932634
   04022 cGMP - PKG signaling pathway
    100932634
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100932634
  Cell communication
   04540 Gap junction
    100932634
 Organismal Systems
  Immune system
   04611 Platelet activation
    100932634
   04062 Chemokine signaling pathway
    100932634
  Endocrine system
   04911 Insulin secretion
    100932634
   04912 GnRH signaling pathway
    100932634
   04913 Ovarian Steroidogenesis
    100932634
   04915 Estrogen signaling pathway
    100932634
   04914 Progesterone-mediated oocyte maturation
    100932634
   04921 Oxytocin signaling pathway
    100932634
   04918 Thyroid hormone synthesis
    100932634
   04916 Melanogenesis
    100932634
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100932634
   04270 Vascular smooth muscle contraction
    100932634
  Digestive system
   04970 Salivary secretion
    100932634
   04971 Gastric acid secretion
    100932634
   04972 Pancreatic secretion
    100932634
   04976 Bile secretion
    100932634
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100932634
   04961 Endocrine and other factor-regulated calcium reabsorption
    100932634
  Nervous system
   04724 Glutamatergic synapse
    100932634
   04727 GABAergic synapse
    100932634
   04725 Cholinergic synapse
    100932634
   04723 Retrograde endocannabinoid signaling
    100932634
  Sensory system
   04742 Taste transduction
    100932634
   04750 Inflammatory mediator regulation of TRP channels
    100932634
  Environmental adaptation
   04713 Circadian entrainment
    100932634
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    100932634
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100932634
  Infectious diseases
   05166 HTLV-I infection
    100932634
Enzymes [BR:shr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100932634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 1158 aa AA seqDB search
MSWFSGVLVPKVDERKMAWGERNGQKRPHRGSRGSGFCGAHYMSCLQDAEPPSPTLPAPP
RCLWQDDAYSPKGGQIGGKELGLRSVALDLEDNETATLSGMPGSASSCWQHLARVFQSKQ
FRSAKLERLYQRYFFQMNQSSLTLLMGVLVLLTAVLLAFHAAPAHPHPAYVALLAGAAAL
FVALMVVCNRPGFHQDSMWVVSYVVLAVLAAVQVGMALVASPQSASAGLWCPVFFVYITY
TLLPVRMRAAVLNGLGLSVLHLLVTWQLNKGDTFLWKQLSANVLLFLCTNIIGICTHYPA
EVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVALEMKEDINTKKEDMMFHKI
YIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCY
YCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKW
QFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQQIETF
LILGASQKRKEEKAMLAKLQRTRANSNEGLMPRWVPDRSFSRTKDSKAFRQMGIDDSSKD
NRGAQEALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQTPELEKKYSRKVDARFG
GYVACMLLVFCFVCFIQLFVVPHSVLMLGLYISIFLLLTVTVLVCAIYSCGTLFPKFLQH
LSRSIVCSRAHSTAVGIFSVLLVFIAAIANMFTCNHTPIRICAARMLNLTPTDITACHLQ
HLNYSLGSDVPLCEGTTPTCSFPEYFNGSLLLSLLAGSVFLHISSIGKLLLTLVLGLLYL
ALLLLGPPAAVFDNYDLLLRAHALSLANETLYGPDCTAGEKVALKYMTPVILLVFALALY
LHAQQVESTARLDFLWKLQATGEKEDMEKLQAYNRRLLHNILPKDVAAHFLARERRNDEL
YYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEEQFRQLEKI
KTIGSTYMAASGLNAATYDRVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNIG
PVVAGVIGARKPQYDIWGNTVNVSSRMDSTGIPDRIQVTTDLYQVLAAKGYQLECRGVVK
VKGKGEMTTYFLNGGPNS
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtttagtggtgtcctggtgccaaaggtagatgagcggaagatggcatggggt
gaacgaaatggacagaagcgcccacaccgaggaagcaggggcagtggcttttgtggtgcc
cactacatgagctgcctccaggatgctgagccaccaagccccactcttccagcccctcca
cggtgtctgtggcaggatgatgcctattccccaaaggggggccaaattggagggaaggaa
ctagggctgaggagtgtggccctggacttggaggacaatgagacagcaacactcagtggg
atgcctggaagtgcaagttcttgttggcaacatctggcaagagtgtttcaatcaaaacag
tttcgatcagctaaactggaacggctctaccaacgctatttcttccaaatgaaccagagt
agcttgaccttgctaatgggggtgctggtgctattgacagctgtccttctggctttccac
gctgcccctgctcaccctcaccctgcctatgtggcactcctggctggggctgctgctctc
tttgtggccttgatggtggtatgtaaccgtcctggatttcaccaggattccatgtgggtg
gtgagctacgtagtgctggctgttctggctgctgtgcaggtgggcatggctttggtggct
tctcctcaaagtgcctcagctgggctgtggtgcccggtgttctttgtttacatcacttat
accctgttacctgtccgaatgagggcagctgtgctgaatggcctgggactctcagttctc
cacctgcttgtcacctggcagctcaacaaaggtgacaccttcctctggaagcagctcagt
gccaacgtgctcctgttcctctgtaccaatatcattggcatatgcacgcactatccagct
gaagtgtctcaacgtcaggccttccaggagactcgaggctacatccaggcccggctacac
cttcagcatgagaaccggcagcaggagcgactactgctctcagtcttgccccagcatgtt
gccttggagatgaaagaggacataaacaccaagaaagaggacatgatgtttcataagatc
tatatccagaagcatgataatgtcagcatcctgtttgctgacatcgagggcttcaccagc
ctggcctcccagtgtactgcacaggaattggtcatgacccttaatgagctcttcgcccga
tttgataaactagctgcggaaaatcactgcctacggatcaagatcttgggggactgttac
tattgtgtctctggattaccagaggcccgtgctgaccatgcccactgctgcgtggaaatg
ggtgtggacatgatcgaggctatctcgttggtgcgggaggtcacaggtgtgaatgtgaat
atgcgtgtgggtatccacagtggtcgtgtacactgtggtgttctaggccttcggaaatgg
cagtttgatgtctggtccaatgatgttaccttggcaaatcacatggaggctggaggccgg
gcaggccggatccacattaccagggctactctgcaatatctaaatggtgactatgaagta
gagcctggcaggggtggtgagcggaacgcctatctcaaagagcagcagattgagaccttc
ctgattctgggggccagtcaaaaacggaaggaggaaaaagccatgttggcaaagctacaa
cggactcgagctaactccaatgagggactgatgccacgttgggtgccagatcgttccttt
tctcgaaccaaggactctaaggctttccgccagatgggcatcgatgattcaagtaaagac
aatcgtggtgcccaggaagccctgaacccagaggatgaggtggatgaattcctgggtcgt
gccattgatgcccgaagtattgatcagttgcgcaaagaccatgtacgtcgattccttctc
acctttcagacgccagaacttgaaaagaagtattcccggaaggtggatgcccgttttggg
ggttatgtggcctgcatgctgctagtcttctgtttcgtctgcttcatccagctttttgtc
gtcccacattcagtactgatgcttggactctatatcagcatcttcctgctgctgacagtt
acagtcctagtttgtgcaatctactcctgtggcactctattcccaaagttcctgcagcac
ctctcccgtagcatcgtttgttcacgggcccacagcacagcagttggcatcttttctgtc
ttacttgtcttcatcgctgccatcgccaacatgtttacctgtaaccatactcctatacgg
atctgtgcggctcgaatgctgaacctgacacctacagacatcactgcctgtcacctgcag
catctcaactactcacttggctcggatgtccctctctgtgagggtactacacctacctgc
agctttccagagtatttcaatgggagtctgctgttgagtctcctagctggctctgtcttc
ctgcacataagcagcattggcaagctgctattgacacttgttctgggactgctatatctg
gcattgcttcttctggggcccccagctgctgtctttgacaactatgacctgctgcttcgg
gctcatgcactgtcacttgccaatgaaactctgtatgggccagactgtactgcaggtgag
aaagtggcactgaagtatatgacacctgtcatcctgttagtgtttgcattagcactctac
ttgcatgcccaacaagtggaatcaactgctcgactggactttctgtggaaattgcaggca
acaggggagaaagaagatatggaaaaactccaggcctataaccgacggttactacacaac
atcctacccaaggatgtggcggcacatttcctagcccgagaacggcgtaatgatgaactt
tactatcagtcttgtgaatgtgtggctgtcatgtttgcctccattgcaaacttctctgaa
ttctatgtggagttggaagccaataatgaaggcgttgaatgcctacgactgctcaatgag
attattgctgactttgatgagatcatcagtgaagaacagttcaggcagctggaaaagatt
aaaacaattggcagcacctatatggcagcctcaggattgaatgcagccacatatgatcgg
gtggggcgttcccatatcactgcacttgctgactatgccatgcggctcatggaacagatg
aagcacatcaatgaacactccttcaataacttccagatgaaaattgggctgaacattggc
ccagtagtggcaggcgtcattggggcaagaaagccacagtatgatatctggggcaataca
gtgaatgtgtcgagccgtatggacagcacaggaatccctgaccgaatccaagtgaccact
gacctgtaccaggttctagctgccaagggctaccagttggagtgtcgaggggtggtcaag
gtgaagggtaagggggagatgaccacctacttcctcaatggtggccccaacagttag

DBGET integrated database retrieval system