KEGG   Sarcophilus harrisii (Tasmanian devil): 100932639Help
Entry
100932639         CDS       T02286                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100932639 (FLNC)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100932639 (FLNC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100932639 (FLNC)
  Infectious diseases
   05132 Salmonella infection
    100932639 (FLNC)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100932639 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 2721 aa AA seqDB search
MNNSNYPEGLGEEMDEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLGDLQRDL
SDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDSKAIVD
GNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPITNFNKD
WQDGKALGALVDNCAPGLCPNWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPN
VDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKATAYGPGIEPHGNTVLQPAHFTVQTVD
AGLGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKATVLFAGQNIERSPF
EVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGNGDVSVVIVDPQGRRDTV
EVALEDKGDSTFRCTYRPVLEGPHTVHVAFAGSPISRSPFPVHVAEACNPNACRAAGRGL
QPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKIREAGDGVFECEYYPVVPGK
YVVTITWGGYAIPRSPFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTL
GFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQPAPPD
CFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDAEGCPIDIKVVPNGDG
TFRCSYVPTKPIKHTIIVTWGGVNVPKSPFRVNVGEGSHPEKVRVYGPGVEKTGLKANEP
TYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGHYTIM
VLFANQEIPASPFHIKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVLTKGAGKAKLDV
HFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVNVAPPL
DLSKVKVQGLNSKVAVGQEQAFSVSTRGAGGQGQLDVRMTSPSRRPIPCKLEPGGGADAQ
AVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGTPAPFS
IDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAHIPGSP
FKADIRPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVKAEVLI
QNNADGTYHITYSPAFPGTYTITIKYGGHPVPKFPSRVHVQPAVDTSGVKVSGPGVEPHG
VLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAYEEGVH
LVEVLYDDVAVPKSPFRVGVTEGCDPSRVRAYGPGLEGGLVNKANRFTVETRGAGTGGLG
LAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKDVVDPG
KVKCSGPGLGAGVRARVPQTFTVDCSQAGRAPLQVAVVGPTGVAEPVEVRDKGDGTHTVN
YTPATDGPYTVAVKYADQEVPRSPFKIKVLPAHDASKVRASGPGLNASGIPASLPVEFTI
DARDAGEGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGDEIPYS
PFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVTCTVST
PDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPIPHVEEP
CDTLQLRQPFPTHQPSSYPTHWATDEPVVPAEPMESMLRPFNLVIPFTVQKGEITGEVRM
PSGKTARPNITDNKDGTITVRYAPSEKGLHEMGIKYDGNHIPGSPLQFYVDAINSRHVSA
YGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTAPG
DYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAP
SGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIGDASKV
RVWGKGLSEGHTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVTYCPTE
PGNYTINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAASIASVGSTCDLNLKIPGNW
FQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGD
FLGRERLGSFGSISRQQEGEVGSQDMTAQVTSPSGKTEEAEILEGENSAYSVRFVPKEMG
PHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWTREAGA
GGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVVPVASL
SDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSELDSDKH
TIRFIPHENGVHSIDVKFNGSHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSS
EFIVNTLNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGGPQHIV
GSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGSSYSSIPKFSSDASKVVTRGPG
LTKAFIGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDY
ILIVKWGDESVPGSPFKVNVP
NT seq 8166 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagcaactacccagagggcctgggcgaggagatggacgagatgccgtccact
gagaaggacctggccgaggacgcgccgtggaagaagatccagcagaacaccttcacccgc
tggtgtaacgagcatttaaagtgcgtgggcaagcgcctgggggacctccagagggacctg
agcgacggcctgcgcctcatcgccctgctcgaggtgctgagccagaagcgcatgtaccgc
aagttccacccgcggcccaactttcgccagatgaaactcgaaaacgtgtccgtggcgctc
gaattcttggagcgcgagcacatcaagctcgtgtctatcgatagcaaggccattgtggat
gggaacttgaagctgatcctgggtcttatctggactctgatcctgcattactccatctcc
atgcccatgtgggaggatgaggatgatgaagatgctcgcaaacagacccccaagcagcgg
ttacttggctggatccagaataaggtgccccagctgcccatcaccaacttcaacaaagac
tggcaggatggcaaggccctgggagcccttgtggacaactgtgcccctggcctgtgtccc
aactgggaggcgtgggatcccaaccagccagtggagaatgcccgagaggcaatgcaacag
gcggatgactggctgggtgtgccacaggtgattgcccctgaggagatcgtggaccccaat
gtggatgagcactccgtcatgacctacctgtcccagttcccaaaggccaagctcaaacct
ggagcccctgtccgctccaaacagctgaatcccaagaaggccaccgcctatgggcctggc
attgagcctcatgggaacacagtgcttcagccagctcattttactgtacagacagtagat
gcaggactgggggaggtgctcgtatacatcgaggaccccgagggccacactgaggaggcc
aaagtggttcccaataatgacaaggaccggacctacgctgtttcctatgtacccaaggtg
gcagggctacacaaggcgacagtgctctttgctggccaaaatatcgagcgtagccccttt
gaggtgaacgtaggcatggccctgggtgatgctaacaaggtgtcagctagaggacctggc
ctggagccagtgggcaacgtggccaacaaacccacctactttgatatctacactgcaggg
gcaggaaatggcgatgtttcggtggtgattgttgaccctcagggtcggcgggacacagta
gaagtggcactggaggataagggggacagcaccttccgctgcacctaccggcctgtgctt
gaggggccccacacagtacacgtggcctttgccgggtcccccatcagtcgaagccctttc
cccgttcatgtggctgaagcttgcaacccgaacgcttgccgggcagcgggccgtggcctc
cagcccaagggtgtccgagtaaaggaggtcgcagatttcaaggtgttcaccaagggagcg
ggcagtggagaactcaaagtcaccgtgaaagggccaaagggtacagaggaaccagtgaag
attcgggaggcaggtgatggcgtgtttgaatgtgaatactatcctgtggtccctggaaaa
tatgtggttaccatcacatggggcggctatgccatcccgcgcagcccctttgaggtacag
gtgagtcctgaggctggagtccagaaagtgcgggcctggggtcctggcctggagacgggc
caagtgggcaagtcagctgactttgtggtggaggccatcggcacagaggtgggaacactg
ggcttctccatcgagggaccatcccaggctaagatcgaatgtgatgacaagggagatggc
tcgtgtgatgtgcgttattggcctacagagccaggagagtatgctgtccatgtcatctgt
gatgacgaagatatccgtgactctcccttcatcgcccacattcagcctgcccctccagat
tgcttcccagacaaggtgaaggcctttggaccagggttggagcctacagggtgcatcgtg
gacaaaccagcagagttcaccatcgatgctcgtgctgctggcaagggtgacctcaagctc
tatgcccaggatgctgaaggctgccctattgatatcaaggtggttcccaatggagatgga
actttccgatgctcctatgtgcccactaaacccatcaagcacaccatcattgtcacttgg
ggaggagttaatgttcccaagagccccttccgggtaaatgtgggagagggaagtcatcct
gagaaggtgagggtgtatggtccaggagtagagaagactggcctgaaggctaatgaacca
acctactttaccgtggactgcagtgaagctgggcaaggggatgtgagcattggcattaag
tgtgccccaggcgtggtgggtcctgctgaagccgacattgattttgatatcatcaagaat
gacaatgataccttcactgtcaagtacacgccccctggggctggccactacaccatcatg
gtgctgtttgctaaccaggaaatcccagccagccccttccacatcaaagtggacccatcc
cacgatgccagcaaggtcagggccgagggtccagggctcaaccgcacgggcgtggaagtt
gggaagcccacacactttacggtgctgaccaaaggtgctggcaaggccaagctggatgtt
cactttgctggggcagcaaagggagaggctgttcgagacttcgagatcattgacaaccat
gactattcctatactgtcaagtatacggctgtccagcagggaaacatggcagttactgtg
acttacgggggggatcctgttcctaaaagtccatttgtggtgaacgtggcaccccctctg
gacctcagcaaggtcaaagttcaaggccttaatagcaaggtagcagtgggacaggaacag
gcgttctcagtgagcacccggggtgcaggcggccagggacagttggatgtacggatgact
tcaccctcacgccgacccatcccctgcaagctggagccaggaggtggagcagacgctcag
gctgtccgctacatgccccctgaggaggggccttacaaggtggacatcacctacgatgga
cacccggtgcctggcagcccctttgctgttgaaggtgtccttcctcctgacccctccaag
gtgtgcgcttatggccccggactcaagggtggcttggtggggacaccagcaccattttcc
atcgacacaaagggggcaggaacagggggcctggggctgacagtggaaggtccctgtgag
gctaagattgagtgccaggataacggcgatggctcatgtgcagtgagctacctgcccacg
gagccaggagaatacaccatcaacatcctctttgctgaggctcacatccccggttcaccc
ttcaaggccgacatccgcccggtctttgatcctagcaaggttcgggctagtgggcctggg
ctggagcgaggcaaggctggggaagcggccaccttcactgtggactgctcagaagcgggc
gaggccgagctgaccattgagatcctgtcggatgccggagtgaaagccgaggtgctaatc
cagaacaacgctgatggcacctaccacatcacctacagccctgctttccctggcacctac
accattaccatcaaatatggaggacatcccgtacccaaattcccttcccgcgttcacgtc
cagccggcggttgatactagtggcgtcaaggtctctggacctggtgtggagccccatggt
gttctccgagaggtgaccacagagttcacagtagatgctcgatccctgactgctaccggt
gggaaccacgtcacagcccgggtcctgaatccctcgggagctaagactgacacctatgtg
acagacaatggggacggcacctaccgagtgcagtacacggcctatgaagaaggagtccac
ttggtagaggtattatatgatgacgtggcagtgcccaagagcccgttccgtgtcggtgtg
accgaaggctgcgacccttcccgcgttcgggcctatgggcctggcctggaaggagggctg
gtcaacaaagccaaccgctttacggtagagaccaggggagctggcactggaggcctgggc
ctggctattgaaggtccctcagaggcaaagatgtcctgcaaggacaacaaggatggcagc
tgcagtgtggagtatatcccctttactcccggagactatgatgtcaacatcacttttgga
gggcgtcctattccagggagccccttccgagtgccagtgaaggatgtggtggatcctgga
aaggtgaagtgttcaggccccggtctaggagctggcgtccgagccagggtcccccagacc
ttcaccgtagattgcagtcaagccggacgagccccactgcaagtggcagtggtgggaccc
acaggagtggctgaaccagtagaagtgcgagataagggagatggtacccacacggtgaac
tatacgccagccactgatgggccatacactgtggctgtcaaatatgctgaccaggaggtg
ccacgcagccccttcaaaatcaaagtgctgccagctcacgatgccagcaaggtccgagca
agtggtccgggactcaatgcctcaggcatcccagccagccttcctgtggagttcaccatt
gatgccagagatgctggagagggactgcttactgtccagatcctggaccccgagggcaaa
cccaagaaggcaaatatacgagacaatggagacggcacatacactgtctcctacctgccg
gacatgagcggccgatacaccatcaccatcaagtatgggggtgatgagatcccctactct
cccttccgaatccatgccttgcctactggggatgccagcaagtgccttgtcactgtgtcc
attggcggacatggcctgggtgcatgtctgggcccccgcatccagattggggaggagaca
gtcatcacagtggatgccaaggcggcaggaaagggcaaggtgacgtgcacggtgtcgacc
ccagacggggcagagctggatgtggatgttgtggaaaaccacgatggcaccttcgacatc
tactacaccgcccctgagccgggcaagtacgtcatcaccatccggtttggaggagagcat
atccctaacagccccttccacgtcctggcgtgtgaccccattccccatgtggaggagcca
tgtgacaccttacagctgcgccagcctttccctacacaccagcccagtagctaccccacc
cactgggccacagatgagccagtggtcccagcagaacccatggagtccatgttgagaccc
ttcaatttggttatcccattcacagtccagaagggagagatcacaggtgaggtacggatg
ccctctgggaagactgcaagacccaatatcacagataataaggacggcaccatcacagtg
agatatgcgcccagtgagaagggacttcatgaaatggggatcaaatacgatggcaatcac
attcctggaagccccctgcagttctatgttgatgccatcaatagccgccacgtgagtgcc
tatgggccaggcttgagtcatggcatggtcaataaaccagccaccttcacaattgtcacc
aaggatgctggcgaagggggcctgtctcttgctgtggaaggcccatctaaagcagagatc
acctgtaaggacaacaaagatggcacctgtacggtatcctacctccctactgctcctggg
gactatagcatcattgtccgttttgatgacaaacacatcccagggagtcccttcactgcc
aaaatcacaggtgatgactcaatgcggacttcacagttgaatgtgggcacatctacggac
gtgtcactgaagatcacagagagtgacctgagtctgctgactgccagcatccgggctccc
tcaggcaatgaggagccctgtctgctcaaaaggctgcctaaccggcatattggtatctca
tttacacccaaagaagtgggtgagcatgtagtgagtgttcggaagagtgggaagcatgtc
accaacagccccttcaagattcttgtgggaccttcagagattggtgacgctagcaaggtt
cgagtctggggcaaaggtctgtcagaaggccacaccttccaggtggcagaattcattgtg
gacacaagaaatgcagggtatggtggtttggggctgagcattgagggccccagcaaggtg
gacatcaactgtgaggacatggaagatggtacttgcaaagtgacctattgtcccactgag
cctggcaactacaccatcaacatcaaatttgctgataagcatgtgcctgggagtccattc
actgtgaaggtgactggtgaggggcggatgaaagagagcattacacggcgcaggcaagca
gcttccatcgcctctgtggggagcacctgtgacctcaacctgaagatcccaggaaactgg
ttccagatggtctctgcccaggagcgcctgaccagaacattcacaaggagtagtcataca
tacacacggacagagaggacagagatcagcaaaacgcggggtggggaaaccaagcgagag
gtcagggtggaggagtccactcaagtcgggggagatcccttccctgctgtctttggagat
ttcctgggtcgtgagcgcctcggctcttttggcagtattagcagacaacaggaaggtgag
gtgggctctcaggacatgacggcccaggtgaccagcccctcggggaagactgaagaagca
gagatcctggaaggagagaacagtgcctacagtgtgcgttttgtgcccaaagagatgggg
cctcacactgtcactgtcaagtatcggggccagcacgttcccggcagccccttccagttt
accgtggggccccttggtgaagggggtgcccacaaggtgcgagctgggggcacaggactc
gagcgtggtgttgcaggagtgccagctgaattcagcatctggacccgggaagcaggggct
ggaggcttatctattgctgtggaggggcccagcaaagctgagatcgcatttgaagaccgc
aaggatggttcctgtggtgtctcctatgttgtccaggagccaggtgactatgaggtctcc
atcaagttcaatgatgagcacatacctgacagccccttcgtggtacctgtggcctccctc
tctgatgatgctcgacgcctcaccgttactagcctccaggagactgggctgaaggtgaac
caaccagcttcctttgcagtgcagctgaatggtgcccgtggtgtgattgatgctagggtg
cacaccccctcaggagctgtagaggagtgctacgtctctgagctagacagtgacaagcac
accatccgcttcatcccccatgagaatggcgtccattctatcgatgtcaagttcaatgga
tctcacatccctggaagccccttcaagattcgtgttggagagcaaagccaagctggagat
ccagggctggtttcagcctatgggcctgggcttgagggaggaactactggtgtatcttct
gaattcattgtgaacaccttgaatgcgggctcaggggccttatctgtcaccattgatggc
ccctctaaagtgcagctggactgtcgggaatgcccagaaggccatgtggtcacctacacc
cctatggccccaggcaactacctcattgctatcaagtatggtggcccccagcacattgtg
ggcagccccttcaaggctaaggttacagggccccggctgtcaggaggccacagccttcat
gagacctccacagtgcttgtggagacagtgaccaagtcgtcctccagccgtggctccagt
tacagctccatccccaagttctcctcagatgccagtaaggtggtgaccaggggtcctggg
ctgaccaaggccttcataggccagaagaactccttcacagtggactgtagcaaagcaggc
accaacatgatgatggtgggtgtacatgggcccaagactccttgtgaggaggtatacgtg
aaacacatgggaaaccgcgtgtacaatgtcacctacactgtcaaggaaaagggggactac
atcctcattgtcaagtggggagatgaaagtgtcccaggcagtcccttcaaggtcaatgtg
ccctga

DBGET integrated database retrieval system