KEGG   Sarcophilus harrisii (Tasmanian devil): 100932643Help
Entry
100932643         CDS       T02286                                 

Gene name
C1GALT1
Definition
(RefSeq) core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  KO
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100932643 (C1GALT1)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100932643 (C1GALT1)
Glycosyltransferases [BR:shr01003]
 Glycan extension
  Type 3 chain
   100932643 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 410 aa AA seqDB search
MLGKLGPHGHRFLGLWLRRGAVCTFFSPRGPGVCDEPPVPAEGRPQEMASKSLPSLLTFL
CGSVVGFFLCYQILHILLEKPAETQPHIIHNDPHARHAEDSAHGHLEGQMDFGADISQHR
DEDKHVAEELYHRVRVLCWVMTGPQNLEKKARHVKATWGRRCNRLLFMSSEENKDFPTVG
LDAREGRDQLYWKTIRAFQYVYEHHPDEADWFMKADDDTYVVLDNLRWLLARHDPAKPIY
FGRRFKPYVKQGYMSGGAGYVLSREALRRFVEAFRTNRCSHSSSVEDLALGKCMEAIGVE
AGDSRDPSGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDS
TTMYQLEYLVHHLRPYGYSYRYQPALPEAPAKQASEADRKEGPQEKSGNR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaaagcttgggccccatggccacaggttcctgggtctgtggctaaggcgggga
gccgtgtgtaccttcttcagccccaggggtccaggagtctgtgatgagccccctgtccct
gcagaggggcgcccccaggaaatggcctccaagtcgctccccagcctgctcactttcctg
tgtggctccgtggtgggcttcttcctgtgctaccagatcctgcacatcctgctggagaag
ccagctgagacccagccacacatcatccacaatgacccgcacgcccggcatgcggaggac
tctgcccacgggcacctcgaaggccagatggactttggggccgacatcagccagcaccga
gatgaggacaagcacgtggccgaggagctctaccacagggtccgggtcctctgctgggtc
atgacggggcctcagaacctggagaagaaggcccggcacgtcaaggccacgtggggccgg
cgctgcaaccgactgctgttcatgagctccgaggagaacaaggacttccccacggtgggg
ctggacgcccgcgagggccgcgaccagctctactggaagaccatccgcgccttccagtac
gtgtacgagcatcaccccgacgaggccgactggttcatgaaggccgacgacgacacctac
gtggtcctggacaacctgcgctggctgctggcccgccacgaccccgccaagcccatctac
ttcgggcgccgcttcaagccctacgtcaagcagggctacatgagtgggggcgccggctac
gtgctcagcagggaggccctgcggaggttcgtggaggccttcaggaccaacaggtgctcc
cacagctcctccgtggaggacctggcgctcggcaagtgcatggaggccatcggcgtggag
gccggagactcccgcgaccccagcggcaaggagaccttccacccctttgtcccagagcac
cacctcatcaagggctacctgcccaagaccttctggtactggaactacaactactacccg
cctgtcgagggcccgggttgctgttcagacctcgccgtttccttccactatgtcgattct
acgactatgtaccagctggagtacctcgtgcaccacctgcgcccctacggttattcctac
aggtatcagcccgccttgcccgaggcacccgccaagcaagcgagtgaagccgacagaaaa
gaaggtccccaagagaagtcggggaaccggtaa

DBGET integrated database retrieval system