KEGG   Sarcophilus harrisii (Tasmanian devil): 100932859Help
Entry
100932859         CDS       T02286                                 

Definition
tyrosine-protein kinase SYK-like
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Osteoclast differentiation
Platelet activation
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100932859
   04151 PI3K-Akt signaling pathway
    100932859
 Organismal Systems
  Immune system
   04611 Platelet activation
    100932859
   04650 Natural killer cell mediated cytotoxicity
    100932859
   04662 B cell receptor signaling pathway
    100932859
   04664 Fc epsilon RI signaling pathway
    100932859
   04666 Fc gamma R-mediated phagocytosis
    100932859
  Development
   04380 Osteoclast differentiation
    100932859
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100932859
  Infectious diseases
   05152 Tuberculosis
    100932859
   05169 Epstein-Barr virus infection
    100932859
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100932859
Protein kinases [BR:shr01001]
 Tyrosine protein kinases
  Syk family
   100932859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 466 aa AA seqDB search
MAASMIDSANHLLFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAFGRKA
HHYTIERELNGTYAIAGGRTHTSPAELCIYHSQESDGLVCLLKKPFNRPPGVEPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRLESEQI
VLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCRKIGSENGNIDFGMSRPPLPSSHPKSWSTGGFISRIKSYSFP
KAGNKKSHPSNVNRAESSVELNPYVLQRTDALGAEIDMQREALPMDTAVYESPYADPEEI
RPKEVRLDRALLALEEGELGSGNFGTVKRGRYRMKKGEKLVAVKILKNETNDPAIKDELL
REANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQKNK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcagccagcatgattgatagtgcaaaccacttactctttttctttggcaacatcacc
cgtgaagaagcagaagattatcttgttcagggaggaatgagcgatggactttatctgctt
cgccagagtcgcaactacctgggtggctttgcattatctgtggcttttggaaggaaagct
catcattacaccattgagagggagctgaatgggacatatgccattgctggagggaggacc
cacacgagccctgctgaactctgcatttatcattctcaagagtctgatggcctggtctgt
cttctgaaaaaaccttttaataggccacctggagtagaacctaagactggtccatttgaa
gatttgaaggaaaacctcatcagagaatatgtaaaacagacatggaacttgcagggtcaa
gctcttgaacaagctattattagtcaaaaaccacagttggagaagttgattgctaccact
gctcatgagaagatgccatggttccatgggaaaatctctcgacttgagtctgaacagatt
gtcttaatcgggtcaaaaacaaatggaaaatttttgatccgtgcaagagacaacaatgga
tcatatgctctctgtttactccatgaaggaaaagttctacattatcgcattgataaagat
aaaacaggaaaactttctatccctgatggaaaaaagtttgataccctttggcagctggtt
gagcattattcctataaaccagatggactcttacgggttcttacagttccatgtcggaaa
attggctcagaaaatggtaatattgactttgggatgtctcgaccacctcttccatcctct
catcctaagagttggtcaacgggtggatttatctcaagaatcaaatcatactccttccca
aaggctggcaataaaaagtcacatccttccaatgttaaccgggcagaaagttcagtagaa
cttaatccttatgtgctacagaggacagatgctttgggagctgaaatagacatgcagagg
gaagccttaccgatggacaccgcagtctatgaaagtccctatgctgatccagaagaaatc
agacccaaagaagtgcgtctggacagagcattgctagctttggaagaaggagaacttggc
tctggtaactttggcactgttaaaaggggtcggtataggatgaaaaaaggtgaaaaatta
gtggctgtaaagatcctcaaaaatgagaccaatgaccctgcaattaaagatgagttatta
agagaggcaaatgtcatgcaacagctagacaatccttacattgtccgaatgattggcata
tgtgaagctgaatcctggatgttagtcatggagatggctgaacttggtccactcaataaa
tatctgcaaaaaaacaagtaa

DBGET integrated database retrieval system