KEGG   Sarcophilus harrisii (Tasmanian devil): 100932898Help
Entry
100932898         CDS       T02286                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100932898 (PFKP)
   01230 Biosynthesis of amino acids
    100932898 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100932898 (PFKP)
   00030 Pentose phosphate pathway
    100932898 (PFKP)
   00051 Fructose and mannose metabolism
    100932898 (PFKP)
   00052 Galactose metabolism
    100932898 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100932898 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100932898 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100932898 (PFKP)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100932898 (PFKP)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100932898 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 801 aa AA seqDB search
MASEGKESKPDSQPAATQFTCKDLAASATHQPTDKKLFENLSGAGKVIGVLTSGGDAQGM
NAAVRAVVRMGIYVGAKMYFVYEGYQGMVDGGNNIVEVTWECVSSILQVGGTVIGSARCQ
AFRTREGRLQAAYNLIQKGITNLCVIGGDGSLTGANLFREEWSGLLEELAKAGKIEKEAV
KKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGR
HCGYLALVSALACGADWVFIPEYPPEEGWEKLLCTKLLENRANKKRLNIIIVAEGAIDIH
NKPITSEKVKDLVVKQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVDAVLALLEATAD
TPACVVSLSGNQSVRLPLMECVHMTQEVQKAMDNCQFAEAVKLRGRSFENNLNTYKLLSQ
KKPDSELPKSNFNVAIMNVGAPAAGMNAAVRSAVRMGISEGHKMFAVNNGFEGFSKGQIK
EITWGGVGGWTGQGGSILGTKRTLPAKYLETIAEQMRIHNINALLVIGGFEGYQGCIQLA
EARPQHQEFCIPICIVPTTISNNIPGTDITLGSDTGLNAIMETCDRIKQSASGTKRRVFI
IETMGGYCGYLASMGGLAAGADVAYIFEEEFDIRELQANVEHLTEKMKTSIQRGLVLRNE
NCNENYTTDFIYQLYSEEGKGIFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVLWLSE
KLKESYRKEEGKVFANTDDSVCLLGMRTRKLIFQPVTELKSETDFEHRIPKEQWWLKLRP
LMKILAKYKISYDVSDSDNQS
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgaggggaaagagagcaagccggattctcagccggcagcgactcagtttact
tgcaaggacttggctgcctctgcgactcatcagccgacagacaagaaattgttcgagaat
ctctccggtgctggcaaagtcatcggggtccttactagcggcggcgatgctcaaggaatg
aatgcagctgttcgagctgtagtgcggatgggaatctatgtgggagccaaaatgtatttt
gtgtatgagggttatcaaggcatggtagatggaggcaataatattgttgaagttacctgg
gaatgtgtttccagtattctccaagtgggaggaacagtcattggcagtgcacgttgccaa
gcattccgtactcgggaaggtcgcttacaagcagcttataacttgattcaaaagggaatt
actaacttgtgtgtgattggtggagatggaagcttaacgggagccaaccttttccgtgag
gaatggagtggactgttggaagaattggctaaagctggtaaaattgaaaaagaagctgtg
aagaaatatgcttacctcaacattgtggggatggtgggctccatagataatgacttctgt
gggacggatatgacaattggcactgactctgctttgcacagaatcattgaagttgtggat
gccattatgaccactgcccagagtcaccagaggacctttgttctggaggttatgggaaga
cactgtgggtatctagctcttgtgagtgccctagcttgtggtgcagattgggtatttatt
cctgaatacccaccagaagaaggctgggagaagcttctctgtactaaactattagagaac
cgtgccaacaagaagaggctgaacatcataattgttgcagaaggggcgattgatatccat
aataaacctattacttcagagaaggttaaggatcttgtagttaaacaactgggatatgat
actcgtgtgacaattcttggacatgtccaaagaggaggaactccttctgcttttgacagg
attctggcaagtcgcatgggtgttgatgctgtactggcccttcttgaggctacagcagat
acccctgcgtgtgttgtttctctgtctggaaaccagtctgtgcgtctgcccctgatggag
tgtgtgcatatgactcaagaagttcagaaggcaatggataattgccagtttgctgaggct
gtgaaacttcgaggaaggagctttgagaacaacctgaacacctataaactgctgtctcaa
aaaaaaccagattcagagcttccaaagagcaattttaatgtggctattatgaatgtgggt
gctcctgctgcagggatgaatgctgctgtccgttcagcagtgagaatgggaatcagtgag
ggtcacaagatgtttgctgtcaataatggctttgaaggattttctaaaggtcagataaaa
gaaatcacctggggaggtgttggaggttggactggccaaggaggatccattcttggcaca
aaacgtactctccctgcaaagtatttggaaacgattgctgaacagatgcgtattcataat
atcaatgctcttttggttattggtggatttgagggttatcaaggttgtatacagctagct
gaggcacggccccaacatcaggagttttgcattcctatatgcattgtgcctactactatt
agcaacaatataccaggcacagacattactcttggtagtgacactggcctgaatgctatt
atggagacctgtgatcgaatcaagcaatcagctagtgggactaagaggcgggtctttatc
atcgagacaatgggtggctactgtggatacctggccagcatgggaggccttgctgccgga
gctgatgtagcgtatatttttgaagaagaatttgacatccgagaactacaggctaatgtg
gaacatttgacagaaaaaatgaagacttccatacaaagaggcctggtgctcagaaatgag
aactgtaatgaaaattataccactgatttcatttatcaactctattctgaggaaggaaaa
ggaatattcgattgcagaaagaatgtcttgggtcacatgcaacagggtggagcaccttct
ccttttgacagaaattttgggacaaaaatttctgccaaagccgtactgtggctctcagag
aaacttaaggaaagctatagaaaagaagaaggaaaagtgtttgccaacactgatgattca
gtctgtctgctagggatgcgtacacgaaaacttattttccaacctgtgactgaattgaag
agtgaaacagattttgagcacagaattcccaaagaacaatggtggttgaaactacgacct
ttgatgaaaattttggccaagtacaaaatcagctatgatgtttctgattcagataatcaa
tcctaa

DBGET integrated database retrieval system