KEGG   Sarcophilus harrisii (Tasmanian devil): 100932898Help
Entry
100932898         CDS       T02286                                 

Gene name
PFKP
Definition
phosphofructokinase, platelet
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:shr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:shr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:shr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:shr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:shr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 801 aa AA seqDB search
MASEGKESKPDSQPAATQFTCKDLAASATHQPTDKKLFENLSGAGKVIGVLTSGGDAQGM
NAAVRAVVRMGIYVGAKMYFVYEGYQGMVDGGNNIVEVTWECVSSILQVGGTVIGSARCQ
AFRTREGRLQAAYNLIQKGITNLCVIGGDGSLTGANLFREEWSGLLEELAKAGKIEKEAV
KKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGR
HCGYLALVSALACGADWVFIPEYPPEEGWEKLLCTKLLENRANKKRLNIIIVAEGAIDIH
NKPITSEKVKDLVVKQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVDAVLALLEATAD
TPACVVSLSGNQSVRLPLMECVHMTQEVQKAMDNCQFAEAVKLRGRSFENNLNTYKLLSQ
KKPDSELPKSNFNVAIMNVGAPAAGMNAAVRSAVRMGISEGHKMFAVNNGFEGFSKGQIK
EITWGGVGGWTGQGGSILGTKRTLPAKYLETIAEQMRIHNINALLVIGGFEGYQGCIQLA
EARPQHQEFCIPICIVPTTISNNIPGTDITLGSDTGLNAIMETCDRIKQSASGTKRRVFI
IETMGGYCGYLASMGGLAAGADVAYIFEEEFDIRELQANVEHLTEKMKTSIQRGLVLRNE
NCNENYTTDFIYQLYSEEGKGIFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVLWLSE
KLKESYRKEEGKVFANTDDSVCLLGMRTRKLIFQPVTELKSETDFEHRIPKEQWWLKLRP
LMKILAKYKISYDVSDSDNQS
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgaggggaaagagagcaagccggattctcagccggcagcgactcagtttact
tgcaaggacttggctgcctctgcgactcatcagccgacagacaagaaattgttcgagaat
ctctccggtgctggcaaagtcatcggggtccttactagcggcggcgatgctcaaggaatg
aatgcagctgttcgagctgtagtgcggatgggaatctatgtgggagccaaaatgtatttt
gtgtatgagggttatcaaggcatggtagatggaggcaataatattgttgaagttacctgg
gaatgtgtttccagtattctccaagtgggaggaacagtcattggcagtgcacgttgccaa
gcattccgtactcgggaaggtcgcttacaagcagcttataacttgattcaaaagggaatt
actaacttgtgtgtgattggtggagatggaagcttaacgggagccaaccttttccgtgag
gaatggagtggactgttggaagaattggctaaagctggtaaaattgaaaaagaagctgtg
aagaaatatgcttacctcaacattgtggggatggtgggctccatagataatgacttctgt
gggacggatatgacaattggcactgactctgctttgcacagaatcattgaagttgtggat
gccattatgaccactgcccagagtcaccagaggacctttgttctggaggttatgggaaga
cactgtgggtatctagctcttgtgagtgccctagcttgtggtgcagattgggtatttatt
cctgaatacccaccagaagaaggctgggagaagcttctctgtactaaactattagagaac
cgtgccaacaagaagaggctgaacatcataattgttgcagaaggggcgattgatatccat
aataaacctattacttcagagaaggttaaggatcttgtagttaaacaactgggatatgat
actcgtgtgacaattcttggacatgtccaaagaggaggaactccttctgcttttgacagg
attctggcaagtcgcatgggtgttgatgctgtactggcccttcttgaggctacagcagat
acccctgcgtgtgttgtttctctgtctggaaaccagtctgtgcgtctgcccctgatggag
tgtgtgcatatgactcaagaagttcagaaggcaatggataattgccagtttgctgaggct
gtgaaacttcgaggaaggagctttgagaacaacctgaacacctataaactgctgtctcaa
aaaaaaccagattcagagcttccaaagagcaattttaatgtggctattatgaatgtgggt
gctcctgctgcagggatgaatgctgctgtccgttcagcagtgagaatgggaatcagtgag
ggtcacaagatgtttgctgtcaataatggctttgaaggattttctaaaggtcagataaaa
gaaatcacctggggaggtgttggaggttggactggccaaggaggatccattcttggcaca
aaacgtactctccctgcaaagtatttggaaacgattgctgaacagatgcgtattcataat
atcaatgctcttttggttattggtggatttgagggttatcaaggttgtatacagctagct
gaggcacggccccaacatcaggagttttgcattcctatatgcattgtgcctactactatt
agcaacaatataccaggcacagacattactcttggtagtgacactggcctgaatgctatt
atggagacctgtgatcgaatcaagcaatcagctagtgggactaagaggcgggtctttatc
atcgagacaatgggtggctactgtggatacctggccagcatgggaggccttgctgccgga
gctgatgtagcgtatatttttgaagaagaatttgacatccgagaactacaggctaatgtg
gaacatttgacagaaaaaatgaagacttccatacaaagaggcctggtgctcagaaatgag
aactgtaatgaaaattataccactgatttcatttatcaactctattctgaggaaggaaaa
ggaatattcgattgcagaaagaatgtcttgggtcacatgcaacagggtggagcaccttct
ccttttgacagaaattttgggacaaaaatttctgccaaagccgtactgtggctctcagag
aaacttaaggaaagctatagaaaagaagaaggaaaagtgtttgccaacactgatgattca
gtctgtctgctagggatgcgtacacgaaaacttattttccaacctgtgactgaattgaag
agtgaaacagattttgagcacagaattcccaaagaacaatggtggttgaaactacgacct
ttgatgaaaattttggccaagtacaaaatcagctatgatgtttctgattcagataatcaa
tcctaa

DBGET integrated database retrieval system