KEGG   Sarcophilus harrisii (Tasmanian devil): 100932999Help
Entry
100932999         CDS       T02286                                 

Gene name
SOS2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Alcoholism
Hepatitis C
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100932999 (SOS2)
   04010 MAPK signaling pathway
    100932999 (SOS2)
   04012 ErbB signaling pathway
    100932999 (SOS2)
   04630 Jak-STAT signaling pathway
    100932999 (SOS2)
   04068 FoxO signaling pathway
    100932999 (SOS2)
   04151 PI3K-Akt signaling pathway
    100932999 (SOS2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100932999 (SOS2)
  Cell communication
   04510 Focal adhesion
    100932999 (SOS2)
   04540 Gap junction
    100932999 (SOS2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100932999 (SOS2)
   04660 T cell receptor signaling pathway
    100932999 (SOS2)
   04662 B cell receptor signaling pathway
    100932999 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100932999 (SOS2)
   04062 Chemokine signaling pathway
    100932999 (SOS2)
  Endocrine system
   04910 Insulin signaling pathway
    100932999 (SOS2)
   04912 GnRH signaling pathway
    100932999 (SOS2)
   04915 Estrogen signaling pathway
    100932999 (SOS2)
   04917 Prolactin signaling pathway
    100932999 (SOS2)
  Nervous system
   04722 Neurotrophin signaling pathway
    100932999 (SOS2)
  Development
   04320 Dorso-ventral axis formation
    100932999 (SOS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100932999 (SOS2)
   05206 MicroRNAs in cancer
    100932999 (SOS2)
   05205 Proteoglycans in cancer
    100932999 (SOS2)
   05214 Glioma
    100932999 (SOS2)
   05221 Acute myeloid leukemia
    100932999 (SOS2)
   05220 Chronic myeloid leukemia
    100932999 (SOS2)
   05211 Renal cell carcinoma
    100932999 (SOS2)
   05215 Prostate cancer
    100932999 (SOS2)
   05213 Endometrial cancer
    100932999 (SOS2)
   05223 Non-small cell lung cancer
    100932999 (SOS2)
  Substance dependence
   05034 Alcoholism
    100932999 (SOS2)
  Infectious diseases
   05160 Hepatitis C
    100932999 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 1329 aa AA seqDB search
MQPPQQPYDFFSEENHPKWRGLFIPALRKVQHQVHPNLSAKEDCLYYIEELILQLLHKLC
IVQPRTVQDVEERVQKTFPHPIDKWAIADAQSAVEKRKRRTPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDESLSSGELNYYDIVRTEIAEERQYLRELNLIIKVFREAFLSNKKLFASSDI
EGIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHEHFNTLMAKPAVSLHFQSIADGFKEAVQYVLPRLMLVPVYHCSHYFELLEQLQE
CSEEQEDRECLKQAITALLNFRCSMERICNKHSPRRRPVDPVCRFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIVQCCNEFIMEGPLIRIGAKHERHIFLFDGLMISCKTNHGQSRIPG
YSNAEYRLKEKFIMRKIQICDKEDTSEYKHIFELISKDENSIIFAAKSTEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSGIPVIKGG
TVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLKLLIERFEIPEPEPSEADKLAVE
KGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLQLLEKLESFISSVKGK
TMKKWVESIVKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQYETFDLMTLHPIEI
ARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAEN
FEERVAVLSRIMEILQVFQDLNNFSGVLEIVSAMNSVSVYRLEHTFEALQERKRKILEEA
VELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKQGKELINFSKRRKV
AEITGEIQQYQNQPYCLRIEAEIRRFFENLNPIGNASEKEFTDYLFNKSQEIEPRNCKQP
PRFPRKTTFSLKSPGIRPHTGRHGSTSGTLRGHPTPLEREPCKISFSRINEAEHESTASA
PTSPNTPSTPPVSASSDLSVFLDTDLNTSYGSNSIFAPVILPPSKSFLNSCGSLHKLTEE
SLVPPPLPPRKKFDQDVSTSKGNVKYDDDPPAIPPRQPPPPKIKPRVPAYSGPFEGPLPS
PPPPPPRDPLPETPLPVPLRPPEHFINYPFNLQPSPMGHTHRDPDWFREASTCPNSPNTP
PSTPSPRVPHRCVLSSNQNNLAHSQAPPIPPRQNSSPHLPKLPPKTYKRDLCQPPVYRLP
LLEHAETPQ
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgccgcaacagccttacgacttctttagtgaagagaaccatccgaaatggcgg
ggactcttcatccctgccctgcggaaggttcagcatcaagttcaccccaatctctcagca
aaagaggattgtctatattacattgaagagttgatccttcaactgctacataaattatgc
attgtacagccaaggactgttcaagatgtagaggaacgtgttcaaaagacttttcctcat
ccaattgacaaatgggctattgctgatgcacaatctgccgtagaaaaacgaaaacgaagg
acccctcttttgttacctgtggataaaattcatcctttattgaaggaagttttagggtat
aaagtagattatcatgtctctctttatattgtggctgtattggaatatatctctgctgat
attctgaaattggctggtaattatgtttttaatatcagacattatgaaatctcccagcag
gacattaaagtatcaatgtgtgcagataaggttttaatggacatgtttgatcaggatgac
attggtttggtttcactctgtgaagatgaatctctttcttcaggtgaactaaattactat
gacatagtcagaactgaaattgcagaagaaagacaatatctacgggaattaaatctaata
ataaaagtatttcgggaggcttttctttcaaacaaaaaactgttcgcatcttctgatatt
gaagggatattcagtaacattttagatattcatgaattgactgtaaagcttttaggcttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcctttagctggaagctgt
tttgaagatctagcagaagaacaagcatttgatccatatgaaaccttatcacaggatatt
ctttcaccacagtttcatgaacatttcaatactttgatggctaaacctgctgtttctcta
cattttcagtccattgctgatggctttaaagaggctgtacaatatgttcttccacgcctt
atgctagtgccagtttaccattgttcacactactttgaattattagagcaattgcaagaa
tgcagtgaagaacaagaagaccgagaatgtttaaaacaagctattactgctcttctgaat
ttccgatgtagcatggaacggatttgcaataagcattcacctagacggcgacctgtggat
cctgtttgtcgattttataatcgtcaattacggagtaagcacctggccattaaaaaaatg
aatgaaattcaaaaaaatattgatggatgggaaggcaaagatattgtccagtgttgtaat
gaatttataatggaaggaccattgataagaataggagctaagcatgaacgccatattttt
ctttttgatggcttaatgattagctgtaaaactaatcatggacaatcccggattccaggt
tatagcaatgcagagtacagattgaaagaaaaatttatcatgaggaaaatacaaatctgt
gataaagaagacacttctgaatacaagcatatctttgagttgatttccaaagatgaaaac
agcattatatttgctgctaagtccactgaagagaaaaataattggatggcagccttgatt
tctcttcagtatcgtagtacattagatcgaatgctagattcagtattattaaaagaagaa
aatgaacaaccattgaggttgccaagtccagaagtttatcgttttgttgtaaaagactcc
gaagaaaacattgtttttgaagacaacttgcaaagtggaatccctgtcattaaaggagga
actgtggtgaaattaattgaaagactaacctaccatatgtatgcagatcccaattttgtg
cgtacttttcttacaacctatcgttcattttgtaagccacaggaattgttgaagttattg
attgaacggtttgaaatccccgagccagaaccttccgaagcagataaattggcagtagag
aaaggagagcaaccaatcagtgcagacctgaaacggtttcgcaaagaatatgtccaacca
gtacaacttaggatactaaatgtatttcggcactgggtagaacatcatttttatgatttt
gagagagatctgcaattacttgaaaaattagaatcctttatttcaagtgtaaaagggaaa
acgatgaagaagtgggtagagtcaattgttaaaatcatcaagaggaaaaaacaagctcag
gcaaatggaattagccataatattacttttgaaagtccaccaccacccattgagtggcat
attagcagaccaggacagtatgaaacatttgatctcatgaccctgcatccaatagaaatt
gcacgtcaactaacacttctggaatctgacctctacagggcagttcagccttctgaactt
gtaggaagtgtgtggactaaagaagataaggaaataaattctccaaatttattgaaaatg
attcggcacactacaaatctaactctctggtttgaaaagtgcatagtagaagcagaaaac
tttgaagaacgagtggcagtattaagtaggattatggagattctgcaagtttttcaagac
ttgaacaatttcagtggtgtgttagagatagtcagtgcaatgaattcagtgtccgtatac
agattggaacatacatttgaagcattacaggaaagaaaacggaagattttagaagaagct
gtagaactaagccaagatcactttaaaaaatacctagcaaaactgaaatcaatcaaccca
ccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaaggtaat
aatgatttccttaaaaaacaagggaaagaattaatcaactttagtaaaagaaggaaagta
gctgaaattactggagaaattcaacagtatcagaatcagccttattgtttacggatagaa
gcagaaataaggagattctttgaaaatctcaaccctataggaaatgcatcagaaaaagaa
tttacagactatttattcaataaatcacaagaaattgaaccccgaaactgtaaacaacca
cctcgatttcctaggaaaacaactttctccttaaaatctcctggtataaggccacatact
ggcagacatggctctacttcaggcactttacgaggtcatccaactccattagaaagagaa
ccatgtaaaataagctttagtcggataaatgaggctgaacatgaatcaacagcatcagca
ccaacctctccaaacacaccatctacgccaccagtctctgcttcttcagatcttagtgta
tttttagatacagatcttaacacttcttatggaagcaacagcatctttgctccagtaatc
ttaccaccttcaaaatctttcttaaattcatgtggtagtttacataaattaactgaagag
tcactggttcctcctcctcttcctcctcgtaaaaagtttgaccaagatgtttcgacttcc
aagggaaacgtgaaatatgatgatgatcctcctgctattccaccaaggcagccaccacct
ccaaaaataaaacctcgagttcctgcttacagtggtccgtttgaagggcctttgcctagt
ccaccaccaccacctccacgagatcctcttcctgagactcctttaccagtacctcttcgg
cctcctgaacattttataaactatccatttaatcttcagccatcaccaatgggacacact
cacagagatccagattggtttcgggaagccagtacatgtccaaactcaccaaatactcct
ccaagcacaccctctccaagggtgccacatcgctgtgtgctcagttccaatcaaaataat
cttgctcattctcaagctccccctatcccaccaagacagaattcaagtcctcacttacca
aaactgccaccaaagacttacaaaagagatctttgtcaacctcctgtatatagattgccc
ttgttagaacatgcagaaactcctcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system