KEGG   Sarcophilus harrisii (Tasmanian devil): 100933028Help
Entry
100933028         CDS       T02286                                 

Gene name
USP4
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 4 isoform X1
  KO
K11835  ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100933028 (USP4)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100933028 (USP4)
Ubiquitin system [BR:shr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100933028 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH Ubiquitin_3 DUSP UCH_1 USP7_C2 USP7_ICP0_bdg CW_binding_1
Motif
Other DBs
NCBI-GeneID: 100933028
NCBI-ProteinID: XP_023353822
Ensembl: ENSSHAG00000016024
Position
2
AA seq 964 aa AA seqDB search
MAEGGGCGQRPDAETQKSELGALMRTALQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
ENNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLVNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPNNMLSCHFSKADTIATIEKEMRKLFNIPDERE
TRLWNKYMSNTYEQLSKPDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTSRAFT
TSPKSSASSYSSMSASPITNGDSANSSGVHSSGLSRGGSGFSNSYSCRESQSHTQPGLCG
LGNLGNTCFMNSALQCLSNTAPLTEYFLKNEYEAEINRDNPLGMKGEIAEAYAELIKQMW
SGRNTQVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDA
NGRPDLVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECSKISVTFDPFCYLTLPLPL
KKDRTMEVFLVSADPQCRPTQYRVTVPMMGAVSDLCEALSKLSGIAAENMVVTDVYNHRF
HKIFQMDEGLNHIMTRDDIFVYEVCNVTEDGSECVTFPVYFRERKIRQTSTSSGTVLYGQ
PLLISVPKHKLTIDYLYQVICERISRYIKHPLPDDSPKPHLDSATCNGSNGICEGEEEME
HQDESKGQPAETETCSSEDSVEHELGNESHQNVPKRVRGQHCKKRLFTFSLVNSYGTTDI
NSLAADGKLLKLNSRSTVAVDWDTETRCLHYDEQESEAYDKHSSMLQPQKKKKTTVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPIRDLHMSEFVCDPAAGPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLASEDQIVTKAAYVLFYQRRDDEFYKAPSLPGFPGPSDAGKKGKRSQEGLEEDDMYS
MDTN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggaggctgcgggcagcggccggacgcagaaacccagaaatccgagctc
ggggccttgatgaggacggcgcttcagcgaggggcacagtggtatctgattgacagccgg
tggttcaagcagtggaagaaatatgtgggctttgatagctgggatatgtacaatgtgggt
gaaaacaacctgtttcctggcccaatagataactccggacttttttcagatcctgaaagt
caaaccttaaaggaacatttaattgacgaactagactatgtattggttcctactgaagcc
tggaataaattagtgaattggtatggctgtgtggaagggcagcaacctatagtcagaaaa
gttgtggaacatggcctatttgtcaaacactgcaaagtagaggtttatttgttggaactg
aagctctgtgaaaacagcgaccccaacaatatgctgagttgccatttcagcaaagcagat
accatagcaaccattgagaaggaaatgcggaaactatttaacattcctgatgagagggaa
acaaggttatggaacaagtatatgagtaatacatatgagcagctcagcaagccagacaac
actgtgcaagatgctggtttataccaggggcaggtactagtcattgagccccaaaatgaa
gatggcacatggcctagacaaacgcttcagtccaaatcaagcactagcagagcttttact
acctctccaaaatcatcagcaagctcctattcctccatgtctgcttctcccattacaaat
ggtgatagtgctaactcttctggcgtgcacagctccggtctcagcaggggaggttctggc
ttctccaattcttatagttgccgagagtctcaatctcacactcaacctgggctttgtgga
cttggaaacctggggaacacctgcttcatgaattctgctttgcagtgcttaagtaacact
gcaccattgaccgaatactttctaaaaaatgaatacgaagctgaaatcaaccgagacaat
cctctgggaatgaaaggggaaattgctgaggcctatgctgaactcatcaaacagatgtgg
tctgggaggaacacccaagtggccccacggatgttcaaaacccaggttggtcgttttgcc
cctcagttttcgggttaccagcaacaggattctcaagagttgttggcctttcttctggat
ggattacatgaggatctgaatcgtgtgaagaagaaaccatacttggagttaaaggatgcc
aatggccgacctgacttggtggtggcaaaggaagcatgggagaatcacaggttaaggaat
gattctgtgatagtggatactttccatggccttttcaaatctacattggtctgcccagaa
tgttctaaaatttctgtgacttttgacccattctgttatttaactctccccttacctctg
aagaaagatcgcactatggaggtattcttggtttctgcagatccgcagtgtaggcctacc
cagtatcgtgtgactgtaccaatgatgggggctgtgtctgacttgtgtgaagctctctca
aagctttctggtattgctgctgaaaatatggtggtcacagatgtgtataatcaccggttc
cacaaaatttttcaaatggatgaaggtttaaatcatattatgacccgggatgacatcttt
gtatatgaagtctgcaatgtaacagaagatggatctgaatgtgtcactttcccagtttac
ttcagagagaggaaaatcaggcagacaagcacatcatctgggactgttctgtatgggcaa
ccattgttaatctctgtcccaaagcacaaattaaccattgactacttgtaccaagttatc
tgtgaacgtatcagccgctacataaagcatcctttaccagatgactctcctaaaccacat
ctagacagtgctacctgcaatggttccaatggcatttgtgaaggagaagaagaaatggaa
caccaagatgaaagcaaaggacaacctgcagaaacagagacctgttcatcagaggactct
gtggaacatgaattgggaaatgagtcccatcaaaatgtcccaaagagagtcagaggccag
cactgcaagaaaaggctttttaccttcagcctggtaaattcctatggcaccactgacatc
aattctcttgcagccgatgggaaactccttaaactgaactctcgttccacagttgctgtt
gattgggacaccgaaacccggtgtcttcactacgatgaacaagaatcagaggcttatgat
aaacacagcagtatgctacagccccagaagaagaagaaaacgacagtggctctccgagat
tgcatagagctcttcactaccatggaaacacttggggagcatgatccctggtattgccct
aactgtaagaaacatcaacaggctacaaagaaattcgacttgtggtccttgccaaaaata
ttggtggttcatctcaagcgattttcatacaacagatactggagagataaacttgacaca
gtagttgaatttccaataagggacctgcacatgtctgagtttgtctgtgacccagcagct
ggcccttatgtctatgacctcattgcagtatcaaatcattatggagccatgggtgtgggc
cactatactgcatatgcaaaaaacaaactgaatggcaaatggtattacttcgatgatagt
aatgtatctctggcctctgaggatcaaatagtgacaaaagcagcatatgtgttgttttac
cagcgccgggatgatgaattttataaggcaccctcactcccgggtttccctggcccctca
gatgcagggaagaaaggaaagcgctcccaggaagggctggaagaggatgacatgtatagc
atggataccaactga

DBGET integrated database retrieval system