KEGG   Sarcophilus harrisii (Tasmanian devil): 100933073Help
Entry
100933073         CDS       T02286                                 

Definition
arachidonate 12-lipoxygenase, 12S-type-like
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100933073
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100933073
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100933073
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100933073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 471 aa AA seqDB search
MEDFEVDVSEDLGPLQFVKLRKIHLLIKDAWFCNHITVWVFEQSMEEKEIVFPCYRWVEG
DGIICLPETTAWMIRNESQGLFQKHQEEELKARRTLYGWVSWKKGIPLSVAAASEKDLPL
DARFHEEKKVDFERTRVVGVTEIALKRLYTLLSSWNSLEDFDQIFWGGKSALAKRVRLSW
KDDDFFGYQFLNGVNPTLLRKSSSLPTRLVIPPGTEDLKAQLERKLQEGCLFEVDFSLLA
GIQANVIQGERQHLAAPLLMLKMEPDGKLLPMVIQLQLPGSDSPVPPLFLPSDPSLTWLL
AKAWVKNSDFQLHELQAHLLKTHLMAEVFAVATMRCLPGMHPIFKLLIPHLRYTLEINTR
ARTKLISNGGFFDQAVNTGGGGHLDVLRRATTCLTYRSLCPPDDLADRGLLGVPSAFYAH
DAVRLWDIISRYVQGIVQLHYLEDEVVRSDPELQAWCREITEIGLCKAQER
NT seq 1414 nt NT seq  +upstreamnt  +downstreamnt
atggaggattttgaagttgatgtctcagaagacctgggtcccctccagtttgtgaagctt
cgtaaaattcatcttctgataaaggatgcatggttctgcaaccatataactgtttgggtc
tttgaacagagcatggaagagaaggaaatagtattcccctgttaccgctgggtagaaggg
gatggtatcatctgccttcctgagaccactgcttggatgataagaaatgaatcccaaggc
ctgtttcaaaaacatcaagaagaagagctgaaggcgagaaggacactctatggctgggtc
agctggaagaaagggataccattgtcagtggctgcagcatcagagaaagacctgcccctg
gatgcaagattccatgaggagaagaaggttgacttcgaaaggacacgggttgtgggggtg
acagaaattgcccttaaacgtctgtacaccctcctgagctcctggaatagcttggaagat
tttgaccaaatcttctggggtggcaagagtgccctggccaagagggtgcgcctatcctgg
aaagatgatgatttttttggctaccagttcctcaatggtgtcaatcccacactgctgaga
aaatcctcttcactccccactcgactcgtgattcccccagggacagaggatcttaaggcc
caactggaaagaaagctccaggagggttgcctctttgaagttgacttttcactgttagct
ggaatccaggccaatgtgatccagggagagaggcaacatctggctgctcccctacttatg
ttaaagatggagcctgatgggaagctgctccccatggtcatccagctccaacttcccggc
tctgactctccagttccaccactcttcctgccttcagatccctccctcacttggcttttg
gccaaggcttgggtcaaaaattctgacttccagctgcatgaactgcaagcacatctgttg
aagacgcatttgatggctgaagtgtttgctgtagccaccatgaggtgcctcccagggatg
caccccatctttaagctcctgatacctcacctccgttatacactggagattaacactcgt
gccaggaccaagctcatctctaatgggggattttttgatcaggcggtgaatactggtggg
ggaggtcacctggatgtcctccgaagggcaacaacttgtctgacctatagatccctctgc
cctcctgatgacctggctgaccgagggcttctgggggtcccatcagctttctatgctcat
gatgccgttcggctctgggacattatctcccgatacgtgcaaggaatagtccagctccat
tatctggaagacgaggttgtgcggagtgaccctgagctacaggcttggtgccgagagatc
actgagattgggctgtgtaaggcgcaggaacgag

DBGET integrated database retrieval system