KEGG   Sarcophilus harrisii (Tasmanian devil): 100933142Help
Entry
100933142         CDS       T02286                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 254 aa AA seqDB search
MAGTPLLHGEFGSYPARGPRFALTLTPVALHVQRLRPRPEAWPQGGLVPLAEVSGCRTLC
SCSPNDSAAYLCVYTYPRGRRGGRRRAARTFRADRAPDYKENHAEAQRWATALTCLLRGV
PLPGDLEITPELLPRPPRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQN
HARELVQGLRLNEWDGIVTVSGDGLLYEPHDGTQNVGDIDGRLPSLGPQTGAAPSASFAP
GEHPPRSFALGPPP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccccactcctgcatggggagtttggctcctatccggcccgaggcccccgc
tttgcactgacactcaccccggtggccttgcatgtgcagcggctgcgccctagaccggag
gcctggccccaggggggcctggtccctctggctgaggtctccggttgccggaccttgtgc
agctgctcccctaacgactctgctgcttacctgtgtgtctacacttatccccggggccgg
cgggggggccgccggcgggcagctcggaccttccgggctgaccgggcccccgactacaag
gagaatcacgcagaagcccagcgctgggccactgctctcacctgcctacttcgaggggtg
cccttgcctggggaccttgagatcacaccggagctcttgccccggcccccccggctgctc
ctattggtcaatccctttggggggcggggcctggcctggcaatggtgtaagaaccacgtg
ctgcctatgatttccgaagcgggcctctccttcaacctcatccagacggagcggcagaac
cacgccagggagctggtgcaggggctgcgactgaacgagtgggacgggatcgtcaccgtc
tccggggacggcctcctgtacgagccccatgatgggacccagaatgtgggggacatcgac
ggcagactgccttccttgggaccccagacaggggctgccccttctgcctcctttgctcct
ggcgagcatcccccccgttcttttgcactaggacctcctccctga

DBGET integrated database retrieval system