KEGG   Sarcophilus harrisii (Tasmanian devil): 100933252Help
Entry
100933252         CDS       T02286                                 

Gene name
HEXA
Definition
hexosaminidase A (alpha polypeptide)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shr00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:shr00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:shr00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:shr00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:shr00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:shr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 569 aa AA seqDB search
MTQRPRYPSVSRTLPLPVGSCSAMPGPGQAGVLPPPLLLLLLPLLAVRTLAAQPEAYVWP
WPQKISVSPNVTFALKPILFRFQYSNSSAVQLGCSVLDQAFVRYLGIIFGPGPWLSRHHP
GLKQTVKNSLEVFVNVPGCDQFPEMNSVENYTLTLSDQQFILKAHTVWGALRGLETFSQL
IWRSAEGMFYVKQTEVVDFPRFPHRGLLLDTSRHYLPLQSILETLDGMAYNKFNVFHWHI
VDDPSFPYESMTFPELSRKGSYNSATHIYTIGDVKKVIEYARMRGIRVISEFDTPGHTLS
WGKGIPGLLTPCYSGSTPSGTFGPVNPILNSTYEFMASFFQEISSVFPDFYLHLGGDEVD
FTCWRSNPDIKAFMKKRGFDRFEKLESFYIQKLLNIVSSYRKGYMVWQEVFDNNVKLNPD
TVVHVWKERSPFPYALEMQNVTKAGFRALLSAPWYLNRISYGQDWQEIYMVDPLDFKGSP
EQKSLVIGGEACMWGEYVDETNLTPRLWPRGGAVAERLWSSQSVRDLDLAYNRLAHFRCE
LLRRGIQAQPLYVGYCEHEYFHRMEQNHP
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaaggcccaggtaccccagtgtctcccggactctccctctcccggtgggctcc
tgctccgcgatgcccgggccggggcaagcgggggtcctgccgccgccgctactgctgctg
ctgctgcccctgctggctgtccgcacgctggccgcgcagcccgaggcctacgtctggcca
tggccgcagaagatctccgtgtcccccaacgtgactttcgccttgaaacccattctcttc
cgcttccagtactccaactcctcggcagtgcagttaggctgctcggtgctcgaccaagcc
tttgtccgctacctcggcatcatcttcgggcccgggccctggctctcccgccaccaccca
ggactgaagcaaacagtgaagaattctttggaagtctttgtgaatgtccctggatgtgac
cagtttccagaaatgaattctgtggagaattacaccttgaccctcagtgatcaacagttc
atcctgaaagctcatactgtctggggagctctcagaggcctagagacttttagccagctc
atttggagatccgcagagggcatgttctatgtcaagcagactgaagttgtagactttcct
cgattccctcaccgaggcttactgctggacacgtctcgtcattacctcccactgcagagc
atcctggagacactggatggcatggcatataacaaattcaacgttttccactggcacata
gttgatgacccttcatttccatatgagagtatgactttccctgagcttagcagaaaggga
tcctacaactctgccactcacatctatacaattggggatgtaaagaaggttattgaatat
gcccgaatgcgaggcatcagagtcatatcagaatttgacacacctgggcacactttgtct
tggggaaaaggtattcctggactgctgactccttgctactcaggcagcactccttctggc
acttttggcccagtaaatcccatcctcaacagcacctatgagttcatggcttcattcttc
caggagatcagctcagttttcccagacttttaccttcaccttggaggggatgaggttgat
ttcacatgttggcgatctaatccagatattaaggccttcatgaagaaaagaggttttgac
cgctttgagaaattggaatctttctacattcaaaagctactgaacattgtgtcttcctat
agaaagggctacatggtgtggcaggaggtgtttgacaataatgtgaagctgaacccagac
accgtggtgcatgtctggaaagaaaggagccctttcccatacgccttggagatgcagaat
gtcaccaaggcagggttccgtgctttgttgtctgcgccctggtacctgaaccgcatctcc
tacgggcaggactggcaggaaatctacatggtggaccccctggactttaaaggcagccct
gagcagaagtctctggtgattgggggcgaagcctgcatgtggggcgaatacgtggacgag
acaaatctgacccccagactctggcccaggggaggagccgtggcagagaggctttggagc
agccagtccgtgagggacttggatttggcgtataaccgactggcccacttccggtgtgag
ctgctcagacgaggtatccaagcccagcctctctatgtaggctactgtgagcatgaatat
ttccatagaatggagcaaaatcatccttga

DBGET integrated database retrieval system