KEGG   Sarcophilus harrisii (Tasmanian devil): 100933361Help
Entry
100933361         CDS       T02286                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100933361 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100933361 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100933361 (LPL)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100933361 (LPL)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100933361 (LPL)
  Exosomal proteins of breast milk
   100933361 (LPL)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100933361 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 473 aa AA seqDB search
MEGKALLLIVLSLCFQSLAVASSNRRRENEDFNDIESKFALRTPEEITEDRCHLVPGDIN
SVAGCNFNHSSKTFVVIHGWTVTGMYESWVPKLVGALFKREPDSNVIVVDWLMRAQQHYP
VSAGYTKLVGQDVARFINWLAEQFNYPWDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGL
DPAGPTFEYAEATSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGFFQPG
CNLFDAINQIATKGLGDMDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLC
LSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKLHFLGTESVTQTNQVL
LISLYGTIAESEEISITLPEMSTNQTYSFLIYTEIDIGELLMVKLQWKSDSFFSWSDWWS
STGFGIQKIRVKAGETQKKVVFCSRDKISHLKKGKDPVVFVKCYDKPLSKKAV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggagggcaaagcgctgcttctgatcgtcctgagtttgtgcttccagagtctggccgtt
gcctcctcaaacagaagaagagaaaatgaagattttaacgatattgaaagtaagtttgcc
ctaaggactccagaagaaatcactgaggataggtgccatcttgttcctggggacattaat
tctgtggctggatgtaacttcaatcatagcagcaaaaccttcgtggtgattcatggatgg
acggtgacaggaatgtatgagagctgggtgccgaaacttgtaggggctctgttcaagaga
gaaccagactccaatgtcattgtagtcgattggttgatgagagcccagcagcattatcca
gtatctgccggctacacaaagctggtaggacaagatgttgccagatttatcaactggctg
gcggaacagttcaactacccatgggacaacgttcatctcttgggctacagccttggcgct
catgctgctggcattgcaggaagtctgacaaataaaaaagttaacagaattactggctta
gatcccgctggacctacttttgaatatgctgaagccaccagccgcctttctcctgatgat
gctgattttgtagatgtattgcacacctttactcgaggatcgcctggccgaagtattgga
atccagaagccagtgggacatgttgacatttatcctaatggaggcttctttcaaccaggg
tgtaatctttttgatgctattaaccaaattgcaacaaaaggtctgggagatatggatcag
ctggtgaaatgttctcatgaacgatccattcatctcttcattgactcccttctgaatgaa
gaaaaccctagtaaggcttaccgctgcagttcaaaggaagcctttgagaaggggctctgc
ctgagttgtaggaagaatcgatgcaacaatatgggctatgagatcaacaaagtgagagcc
aagagaagcagcaaaatgtacctgaagacccgttctcagatgccctacaaagtcttccac
tatcaggtgaaattacattttcttggaactgagagtgtgactcagaccaaccaggtgtta
ttgatctctctatatggcacgatagcagaaagtgaagaaatctctattactctgcctgaa
atgtccaccaaccagacttactccttcctgatttacacggagatagatattggcgagctg
ctcatggtgaaactgcagtggaaaagcgattctttcttcagctggtctgactggtggagc
agcactggctttggcatccagaaaatcagagtcaaagcaggagaaactcagaaaaaggtc
gtcttctgttctagagataaaatctcccatctgaagaaaggaaaagaccctgtggtattt
gtgaaatgctatgacaaacctctgagcaaaaaggctgtctga

DBGET integrated database retrieval system