KEGG   Sarcophilus harrisii (Tasmanian devil): 100933361Help
Entry
100933361         CDS       T02286                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100933361 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100933361 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    100933361 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100933361 (LPL)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100933361 (LPL)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100933361 (LPL)
  Exosomal proteins of breast milk
   100933361 (LPL)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100933361 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shr00537]
 Enzymes
  100933361 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
1
AA seq 473 aa AA seqDB search
MEGKALLLIVLSLCFQSLAVASSNRRRENEDFNDIESKFALRTPEEITEDRCHLVPGDIN
SVAGCNFNHSSKTFVVIHGWTVTGMYESWVPKLVGALFKREPDSNVIVVDWLMRAQQHYP
VSAGYTKLVGQDVARFINWLAEQFNYPWDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGL
DPAGPTFEYAEATSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGFFQPG
CNLFDAINQIATKGLGDMDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKGLC
LSCRKNRCNNMGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKLHFLGTESVTQTNQVL
LISLYGTIAESEEISITLPEMSTNQTYSFLIYTEIDIGELLMVKLQWKSDSFFSWSDWWS
STGFGIQKIRVKAGETQKKVVFCSRDKISHLKKGKDPVVFVKCYDKPLSKKAV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggagggcaaagcgctgcttctgatcgtcctgagtttgtgcttccagagtctggccgtt
gcctcctcaaacagaagaagagaaaatgaagattttaacgatattgaaagtaagtttgcc
ctaaggactccagaagaaatcactgaggataggtgccatcttgttcctggggacattaat
tctgtggctggatgtaacttcaatcatagcagcaaaaccttcgtggtgattcatggatgg
acggtgacaggaatgtatgagagctgggtgccgaaacttgtaggggctctgttcaagaga
gaaccagactccaatgtcattgtagtcgattggttgatgagagcccagcagcattatcca
gtatctgccggctacacaaagctggtaggacaagatgttgccagatttatcaactggctg
gcggaacagttcaactacccatgggacaacgttcatctcttgggctacagccttggcgct
catgctgctggcattgcaggaagtctgacaaataaaaaagttaacagaattactggctta
gatcccgctggacctacttttgaatatgctgaagccaccagccgcctttctcctgatgat
gctgattttgtagatgtattgcacacctttactcgaggatcgcctggccgaagtattgga
atccagaagccagtgggacatgttgacatttatcctaatggaggcttctttcaaccaggg
tgtaatctttttgatgctattaaccaaattgcaacaaaaggtctgggagatatggatcag
ctggtgaaatgttctcatgaacgatccattcatctcttcattgactcccttctgaatgaa
gaaaaccctagtaaggcttaccgctgcagttcaaaggaagcctttgagaaggggctctgc
ctgagttgtaggaagaatcgatgcaacaatatgggctatgagatcaacaaagtgagagcc
aagagaagcagcaaaatgtacctgaagacccgttctcagatgccctacaaagtcttccac
tatcaggtgaaattacattttcttggaactgagagtgtgactcagaccaaccaggtgtta
ttgatctctctatatggcacgatagcagaaagtgaagaaatctctattactctgcctgaa
atgtccaccaaccagacttactccttcctgatttacacggagatagatattggcgagctg
ctcatggtgaaactgcagtggaaaagcgattctttcttcagctggtctgactggtggagc
agcactggctttggcatccagaaaatcagagtcaaagcaggagaaactcagaaaaaggtc
gtcttctgttctagagataaaatctcccatctgaagaaaggaaaagaccctgtggtattt
gtgaaatgctatgacaaacctctgagcaaaaaggctgtctga

DBGET integrated database retrieval system