KEGG   Sarcophilus harrisii (Tasmanian devil): 100933392Help
Entry
100933392         CDS       T02286                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100933392 (GLS)
   00220 Arginine biosynthesis
    100933392 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100933392 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100933392 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    100933392 (GLS)
   04727 GABAergic synapse
    100933392 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100933392 (GLS)
   05206 MicroRNAs in cancer
    100933392 (GLS)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100933392 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 572 aa AA seqDB search
WPKSSFWYYKHVISNKLQILIHSPLLLPFISSKIKQGLLPSLEDLLFYTIAEGQEKIPVH
KFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRR
KFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGD
TKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDRPHNPMVNAG
AIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKE
KKCFPEGTDMVGILDFYFQLCSIEVTCESASVMASTLANGGFCPITGERVLSPEAVRNTL
SLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHF
CHDLVSLCNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAM
DMEQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFK
ILQEYQVQYTPPGDSNDGKENQTVHKNLDGLL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
tggccaaagtctagtttttggtactataaacatgttatatctaacaaactgcaaatatta
attcattctcccttactcctcccctttatttccagtaagatcaaacagggtcttctacct
agcttggaggatttgctgttctataccattgcagaagggcaagaaaaaataccagttcat
aagttcattacagcactgaaatctacaggattgcgaacttctgatcccaggttgaaagag
tgtatggatatgttgagattaactcttcagacaacatcagatggtgtcatgctagacaaa
gatctttttaaaaaatgtgttcaaagcaacattgtgctgcttacacaggcctttaggaga
aagtttgtcattccagactttatgtcgtttacctcacacattgatgaattgtatgaaagt
gctaaaaaacagtctggaggaaaggttgctgattacatccctcaactggccaagttcagt
ccagatttatggggagtatcagtgtgtacagtggatggacagaggcattctattggagat
accaaagtccccttttgtcttcagtcctgtgtaaagcccttgaaatatgccattgctgta
aatgaccttggaacagagtatgtacatcgatatgttggaaaagagcccagcggattaaga
ttcaacaaactcttcctgaatgaagatgataggcctcataatcctatggtgaatgctgga
gcaattgttgtaacttcattaataaagcaaggagtaaataatgctgaaaaatttgactat
gtgatgcagtttttgaataagatggctggtaatgaatatgttggattcagtaatgccacg
tttcaatctgaacgggaaagtggagatcggaattttgcaataggatattacttaaaggag
aaaaagtgttttccagaaggcacagacatggttgggatattagacttctacttccagttg
tgttccattgaagtgacttgtgaatcagccagtgtgatggcttctacattagctaatggt
ggtttctgtccaatcactggtgaaagagtactgagtccagaagcagttcgaaatacacta
agtctgatgcattcttgtggcatgtatgacttctcaggtcaatttgctttccatgttggt
ctccctgcaaaatctggagttgctgggggcattcttttagttgttcctaatgttatggga
atgatgtgctggtctcctccattagataagatgggcaacagtgttaagggaattcacttc
tgtcatgatcttgtttctttgtgcaatttccataactatgataatttgagacactttgca
aaaaaacttgatcctcgaagagaaggtggtgatcagagggtgaaatcagtgataaacctc
ttgtttgctgcatatactggagatgtgtcagcccttagaagatttgctttgtcagcaatg
gatatggaacaacgggactatgattctcgaactgcattacatgttgctgctgcagaaggt
catgtggaagtagttaaatttttgttggaagcctgcaaagtgaatcctttccccaaggac
aggtggaataacactcccatggatgaagctctacattttggacaccatgatgtatttaaa
atccttcaggaataccaagtccagtatacacctccaggagattccaacgatggtaaagaa
aatcagacagtccataagaatctagatggattgttgtaa

DBGET integrated database retrieval system