KEGG   Sarcophilus harrisii (Tasmanian devil): 100933392Help
Entry
100933392         CDS       T02286                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:shr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:shr00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:shr00471]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:shr04964]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:shr04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:shr04727]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:shr05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 546 aa AA seqDB search
MTSGEIKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLR
LTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSG
GKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTE
YVHRYVGKEPSGLRFNKLFLNEDDRPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLN
KMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVT
CESASVMASTLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSG
VAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPR
REGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVK
FLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPPGDSNDGKENQTVHK
NLDGLL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtggagaaattaagatcaaacagggtcttctacctagcttggaggatttgctg
ttctataccattgcagaagggcaagaaaaaataccagttcataagttcattacagcactg
aaatctacaggattgcgaacttctgatcccaggttgaaagagtgtatggatatgttgaga
ttaactcttcagacaacatcagatggtgtcatgctagacaaagatctttttaaaaaatgt
gttcaaagcaacattgtgctgcttacacaggcctttaggagaaagtttgtcattccagac
tttatgtcgtttacctcacacattgatgaattgtatgaaagtgctaaaaaacagtctgga
ggaaaggttgctgattacatccctcaactggccaagttcagtccagatttatggggagta
tcagtgtgtacagtggatggacagaggcattctattggagataccaaagtccccttttgt
cttcagtcctgtgtaaagcccttgaaatatgccattgctgtaaatgaccttggaacagag
tatgtacatcgatatgttggaaaagagcccagcggattaagattcaacaaactcttcctg
aatgaagatgataggcctcataatcctatggtgaatgctggagcaattgttgtaacttca
ttaataaagcaaggagtaaataatgctgaaaaatttgactatgtgatgcagtttttgaat
aagatggctggtaatgaatatgttggattcagtaatgccacgtttcaatctgaacgggaa
agtggagatcggaattttgcaataggatattacttaaaggagaaaaagtgttttccagaa
ggcacagacatggttgggatattagacttctacttccagttgtgttccattgaagtgact
tgtgaatcagccagtgtgatggcttctacattagctaatggtggtttctgtccaatcact
ggtgaaagagtactgagtccagaagcagttcgaaatacactaagtctgatgcattcttgt
ggcatgtatgacttctcaggtcaatttgctttccatgttggtctccctgcaaaatctgga
gttgctgggggcattcttttagttgttcctaatgttatgggaatgatgtgctggtctcct
ccattagataagatgggcaacagtgttaagggaattcacttctgtcatgatcttgtttct
ttgtgcaatttccataactatgataatttgagacactttgcaaaaaaacttgatcctcga
agagaaggtggtgatcagagggtgaaatcagtgataaacctcttgtttgctgcatatact
ggagatgtgtcagcccttagaagatttgctttgtcagcaatggatatggaacaacgggac
tatgattctcgaactgcattacatgttgctgctgcagaaggtcatgtggaagtagttaaa
tttttgttggaagcctgcaaagtgaatcctttccccaaggacaggtggaataacactccc
atggatgaagctctacattttggacaccatgatgtatttaaaatccttcaggaataccaa
gtccagtatacacctccaggagattccaacgatggtaaagaaaatcagacagtccataag
aatctagatggattgttgtaa

DBGET integrated database retrieval system