KEGG   Sarcophilus harrisii (Tasmanian devil): 100933747Help
Entry
100933747         CDS       T02286                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100933747 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 625 aa AA seqDB search
MADVDTSATASEAGTEDVSLFSMTDMFLFSLIVGLLTYWFFFRKKKEEIPEFTKIQPVPP
NVKESSFVEKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYDLADL
SSLPEIENSLAVFCMATYGEGDPTDNAQDFYDWLQETDADLSGVRFAVFGLGNKTYEHFN
AMGKYVDNRLDQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEYFGVEATGEESSI
RQYELVVHTDENMNKVYTGEMGRLKSYENQKPPFDAKNPFLAIVTTNRKLNQGGERHLMH
LELDISNSKIRYESGDHVAVYPANDALLVNQLGEILGADLDVVMSLNNLDEESNKKHPFP
CPTTYRTALTYYLDITNPPRTNVLYELAQYAGEPAEQEQLRKMASSSGEGKELYLSWVVE
ARRHILAILQDYPSLRPPIDHLCELLPRLQVRYYSIASSSKVHPNSVHICAVVVEYKTKA
GRVNKGVATNWLRAKEPAQENGNKATVPMFVRKSQFRLPFKPTTPVIMIGPGTGIAPFMG
FIQERAWLKEQGKHLMKQNKEHLWKLIHEGSAHIYVCGDARNMARDVHNVFCEIASEFGG
MSQSQAVDFIKKLMAKGRYSLDVWS
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgtggacaccagcgccaccgcatcggaggctggaactgaagatgtttccctt
ttcagcatgacagacatgtttctcttttcacttattgtggggctcctgacctactggttc
ttcttcagaaagaaaaaggaagaaatccccgagttcactaaaattcagcctgtacctcca
aatgtcaaagaaagtagctttgtggagaagatgaagaaaacgggtaggaacatcgttgtg
ttttatggctcccagacgggcacagctgaagaatttgctaaccgcctctccaaagacgcc
caccgttacggaatgaggggcatggctgcggaccccgaggagtatgacttggcggatttg
agcagtcttccagaaatagagaactccctggctgtgttctgcatggccacctatggcgag
ggagaccccacagacaatgctcaggacttctatgactggctgcaagagacagatgcggat
ctctctggtgtcagatttgcggtgtttggtcttgggaacaagacctatgaacacttcaac
gcgatggggaaatatgtggacaacaggctggaccagctgggggctcagcggatatttgaa
ctcggcctgggagatgatgacgggaacttggaggaagattttatcacctggagagagcag
ttctggccggccgtttgtgaatattttggagtggaagctactggtgaggagtccagcatt
cgtcagtacgagctggtggttcacactgatgaaaacatgaacaaagtgtacaccggggaa
atgggccgcctgaagagctatgagaaccagaaaccgccttttgacgccaagaatcctttc
ctggccatcgtgaccacaaatcggaagctgaaccagggcggagaacgccatctcatgcat
ctggagctagacatctcaaactccaaaatcaggtacgagtccggggaccacgttgccgtg
tacccagccaatgatgcgttgctcgttaaccagctcggagagatcctgggggctgacctg
gatgtggtcatgtccctgaacaacctggatgaggagtccaacaagaagcatccgttcccc
tgccccaccacttaccgcacggcactcacctactacctggacatcaccaatccccctcga
accaacgtcctctatgagctggcacagtacgctggggagccggcagaacaggagcaactc
cgcaagatggcgtcctcgtcgggcgagggcaaggagctgtacctgagctgggttgtggaa
gccaggaggcacatcctggccattcttcaggactacccctccctccggccccccattgac
cacctatgtgagctgctgccccgcctgcaggtccgctactactccattgcctcctcctcc
aaggttcaccccaactccgttcacatctgtgccgtggtggtggagtataagaccaaggcg
ggccgggtcaacaagggcgtggctaccaactggctccgggccaaggagcccgcccaggag
aacgggaacaaggccaccgtacccatgttcgtgcgcaagtcccagttccggctgcccttc
aagcccaccacgcccgtcatcatgatcggcccgggcaccggcatcgcccccttcatgggc
ttcatccaggagcgggcgtggctgaaagagcagggtaagcacctgatgaagcagaacaag
gagcatctctggaaactgatccacgagggcagcgcgcacatctacgtgtgcggggatgcc
cggaacatggcccgcgacgtgcacaacgtgttctgtgagatcgcgtccgagttcgggggc
atgagccagtcccaggctgtggacttcatcaagaaactgatggcgaaggggcgctactcc
ctggatgtgtggagctag

DBGET integrated database retrieval system