KEGG   Sarcophilus harrisii (Tasmanian devil): 100933766Help
Entry
100933766         CDS       T02286                                 

Definition
cytochrome P450 2C19-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100933766
   00590 Arachidonic acid metabolism
    100933766
   00591 Linoleic acid metabolism
    100933766
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100933766
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100933766
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100933766
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100933766
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100933766
Cytochrome P450 [BR:shr00199]
 Cytochrome P450, animal type
  CYP2 family
   100933766
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 494 aa AA seqDB search
MDLSMVIELGLLLCISCLLLILSWKKNFGKGKLPPGPISLPIIGNILQVNLKNIPESLSV
LAKKYGPVFTLQLGMEHVIVLHGYEAVKEALIDHGDKFADRGHIPILEYISNGLGIGVSN
GERWKQLRRFCLMTLRNFGMGKRSIEERVQEEAKNLVKELEKTKGLPCDPTFILGCAPCN
VICSIIFQKHFDYKDQKFLHLLKLFEEDMKIVSSPWIQVYNCFPSLLHHLPGSHHKVYKI
IHLIYEFIFEEVKEHQKTLDPSNPRDFIDCYLMKMEQEKQQPQSIFTIENLIYIAIDLFS
AGTETTSTTLRYGLLLLLKHPEVTGKIHEEIDRVIGRNRSPCMEDRNKMPYTYAVIHEIQ
RYIDLIPNSLPHAVTQDIHFRQYFIPKGTTIIPSLTSVLYDDKEFPNPNQFDPGHFLDES
GKFKKSDYFMPFSAGKRICLGESLARMELFLFFTTILQNFTLKSPMDPKDIDTTPTASGF
GKVPPFYELCFLSL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggatctatctatggtcattgagcttggcttactgctctgtatttcatgtctgcttctc
attttatcatggaaaaagaactttggaaaaggaaagcttccacctggtcctatttctctt
cccatcattggtaatatattgcaagtgaaccttaagaatatccctgaatctctttctgtg
ctagcaaaaaaatatggcccagtgttcactctgcaattaggtatggagcatgttattgtg
ttacatggatatgaggcagtgaaagaagctctgattgatcacggggacaagtttgcggac
agaggacatataccaattcttgagtacattagtaatggattaggaattggggtaagcaat
ggagaaagatggaagcaactccgtcgcttctgcctcatgaccctgaggaattttgggatg
gggaagagaagcattgaagaaagagtccaagaagaggcgaagaaccttgtgaaagagtta
gaaaaaacgaaaggattaccatgtgaccccacattcattcttgggtgtgctccttgcaat
gtaatctgctctatcatttttcagaaacattttgattataaagaccagaaatttttacat
ttactgaagctttttgaagaagacatgaaaattgtaagttccccatggatccaggtctat
aattgttttccatctctattacatcatctccctggatctcatcataaagtatataaaatt
attcacttaatatatgaatttatttttgaagaagtgaaggaacaccaaaagacactggat
cccagtaatcctcgggacttcattgactgttatctgatgaaaatggagcaggaaaagcaa
caaccacaatctatatttaccattgaaaacttgatctatatagcaattgatctctttagt
gcgggaacagagacaacaagcaccaccttgagatatggactcctgcttctcctgaaacac
cctgaagtaacaggaaaaattcatgaagaaattgatcgtgtgattggtcgaaatcgaagt
ccctgtatggaagatagaaacaagatgccttatacctatgctgtgatacatgagattcag
cgatacattgacctcatccctaacagtctgccccatgcagtgacacaagatattcacttt
agacaatattttattcccaagggtaccaccataataccatcactgacttctgttctgtat
gatgataaagagtttcccaatccaaaccagtttgacccaggtcacttcctggatgaaagt
ggcaagtttaagaaaagcgactatttcatgcctttttcagcaggaaaacgaatatgcctt
ggtgagagcctggctcggatggaattgtttctgttttttactacaatcttacagaatttt
accttgaaatctccaatggacccaaaagatattgacaccaccccaactgccagtggcttt
ggcaaagtaccccccttttatgaactttgctttttatctttgtaa

DBGET integrated database retrieval system