KEGG   Sarcophilus harrisii (Tasmanian devil): 100933842Help
Entry
100933842         CDS       T02286                                 

Gene name
PCMT1
Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase isoform X1
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100933842 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 Ubie_methyltran PrmA Methyltransf_23 GCD14 MTS FtsJ
Motif
Other DBs
NCBI-GeneID: 100933842
NCBI-ProteinID: XP_023359032
Position
4
AA seq 228 aa AA seqDB search
MAWKSGGANHSELIQNLRKNGIIKSEKVFEVMLATDRAHYAKCNPYMDSPQSIGFQATIS
APHMHAYALELLFDQLHDGAKALDVGSGSGILTACFARMVGATGKVIGIDHIKELVDDSI
SNVKKDDPTFLSSGRVKLVVGDGRLGYSEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaagtccggcggggccaatcactcggagctcatccaaaatctccgcaaaaat
ggaataatcaagtcagagaaagtatttgaagtaatgctggccacagaccgtgctcactat
gcaaaatgtaatccctacatggattctccacaatcaataggtttccaagcaacaatcagt
gctccacacatgcatgcatacgctctagaacttctgtttgatcagttgcatgatggagcc
aaagctcttgatgttggttctggaagtggaatccttactgcctgctttgcccgtatggtt
ggtgctactggaaaagtcataggaatcgatcatatcaaggagttagtagatgattcaata
agtaacgtcaaaaaggatgatccaacatttttgtcttcaggacgagtcaaactggttgtg
ggagatggaagattgggatactccgaagaagctccctacgatgctattcatgtaggagct
gcagctccagttgtgccccaagcactaatagatcagttgaagcctggtggaagattgatt
ttaccagttggtcctgcaggtggaaatcagatgctggaacaatatgacaaactacaagat
ggcagcgtcaaaatgaagcctctgatgggggtgatatacgtgcctttaacagataaagag
aagcagtggtccagggatgaattgtaa

DBGET integrated database retrieval system