KEGG   Sarcophilus harrisii (Tasmanian devil): 100933996Help
Entry
100933996         CDS       T02286                                 

Gene name
KCNMB3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:shr04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:shr04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 323 aa AA seqDB search
MQPFNVPIQITLQGSRRRQGRSAFSSSDGRKNKDYGDGKSIQDVPKKLPSTAGEDRAILL
GFAMMGFSVLMFFLLGVTILKPFMLSTQREEANCTIMDTHVKDDWLDCSFTCGVDCRGQG
KYPCLQVSVNLSHSGQKAFLHYNEEAVQINPECFYTPKCHRDRNDLLNSALDIKEFFDHK
NGTPFSCFYSPDSKPEDVVLIKKYDQMVIFHCLFWPSLTLLGGILIVGMVKLTQHLSVLC
EEYNHVGREDRTLNWELPGFGSSLGSCQHDPPQEAWWFTILVWDFVLMPFWSLPLGSSEL
PSCRDPQALISPAVGTPGSGKHA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgttcaacgtccctattcagatcacacttcagggcagccggaggcgccaggga
aggtcagccttctcttcttctgatgggaggaaaaacaaagactatggtgatggaaaatca
atccaagatgtgccaaaaaagctcccctccactgcaggagaagatcgagcgattctcttg
ggctttgcaatgatgggtttctctgtccttatgttttttctgctcggagtcaccattcta
aaacctttcatgctcagcacacagcgagaagaggcaaactgcaccattatggacacacat
gtgaaggacgactggctggattgttcgttcacctgtggggttgactgtcggggccaggga
aagtacccttgtcttcaggtgtctgtaaacctctcccattcgggccagaaagctttcctg
cactataatgaagaagctgttcagataaacccagagtgcttttacacaccaaagtgccat
cgagacaggaacgatctactcaacagcgctctggacatcaaggagttcttcgatcacaaa
aacgggacccctttctcttgcttctacagcccagacagcaaaccagaggatgtggtcctg
ataaaaaagtatgatcaaatggttatcttccactgcttgttttggccatcattgactctg
ttgggcggcatattgattgtggggatggtaaaattaacccaacacttgtcggtgttgtgt
gaagaatacaaccatgtggggagggaggatagaacactgaactgggagctgccaggcttt
ggttctagtctcggttcctgccagcatgaccctcctcaggaagcctggtggttcaccata
ttggtatgggactttgtgctgatgcccttttggtctttgcccttgggcagttcagaactc
cccagctgcagagatccacaagccttaatctctccagcagtaggaactccaggttctgga
aaacatgcatga

DBGET integrated database retrieval system