KEGG   Sarcophilus harrisii (Tasmanian devil): 100934080Help
Entry
100934080         CDS       T02286                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100934080 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 307 aa AA seqDB search
MLPALMITLSCLGFSSLTQAHLVPTVPLGPAPDAFDDAYLDCVEEMEEEVPHLLQEEMAQ
HSLLRESWGAATAAWESRRRELTLPLGFRTQHAVAVMVYTNSSNPLYRELNSAVRTTGSS
REDYMEHFPFKALHFYLMRALQLLRAPESCQEGPGQEVFRGVSSLRFQPKQLGDVIRLGQ
FTSTSEEKGVAQGFGNSTFFTMNTCFGVPIQALSVFPEEREVLLPPHEVFLVSDFSQDGT
RNLVTIRSLNRTCSHFNCAYLGGEKKEGCVSNAGQSWDALPQGSWLQLMPRTLLLPPGAF
QLSGPVP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgccctgatgattacacttagctgcctgggcttcagctccctgacacaggcc
caccttgtccccactgtgcctttgggcccagctcccgatgcctttgatgatgcttacttg
gactgtgtggaggagatggaggaggaggtcccccacctgctccaggaggagatggctcag
cactccctgctccgggagtcctggggagctgccacagctgcctgggagagccggagaagg
gagctcactctgcccctgggcttccgaacccagcacgctgtggctgtcatggtctacacc
aattcatccaaccctctgtaccgggagctgaactccgctgtgaggaccacaggcagctct
cgggaggactacatggagcacttccccttcaaggccctacatttctacctgatgcgggct
ctgcagctgctgagagctccggagagctgccaggagggccctgggcaggaggtgttccga
ggggtgagcagcctccgctttcagcctaagcagctgggagatgtcattcgcctgggccag
ttcacctccacctctgaggagaaaggggtggcccagggatttggaaactccaccttcttc
accatgaacacttgttttggagttcctatacaagccctttcggtcttcccagaggaacga
gaggttctccttccgcctcatgaggttttcctggtgtctgacttctctcaggatgggacc
cgaaacctagtgaccatcaggagcctcaatcggacctgcagccatttcaactgtgcttac
ctgggcggagagaagaaggagggctgtgtatctaatgcaggacaaagttgggatgctctc
ccccaaggatcttggcttcagctgatgccaaggactctgctcctgcctcctggagccttc
caactctcaggcccagtgccctga

DBGET integrated database retrieval system