KEGG   Sarcophilus harrisii (Tasmanian devil): 100934099Help
Entry
100934099         CDS       T02286                                 

Gene name
ACACA
Definition
(RefSeq) acetyl-CoA carboxylase alpha
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100934099 (ACACA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100934099 (ACACA)
   00640 Propanoate metabolism
    100934099 (ACACA)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100934099 (ACACA)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100934099 (ACACA)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100934099 (ACACA)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100934099 (ACACA)
   04922 Glucagon signaling pathway
    100934099 (ACACA)
Enzymes [BR:shr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100934099 (ACACA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100934099 (ACACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 2346 aa AA seqDB search
MDESSPLTKPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSSSPASVNSDTLP
DLGLPSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLRMDWQESDFSKRILNVPQDLYEKGYVKDVDAGLQA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDVPIDFENSAHVPSPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQHNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGAKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYA
EIEVMKMVMTLIAVESGCIHYVKRPGAALDPGCVIAKLQLDNPSKVQQAELHTGSLPKIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFNSKVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFTLREENKSD
MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMAHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSP
PQSPTFPEAGHTSLYDEDKAARDEPIHILNVAIKTDCDIEDDRLAAMFRDFTQQNKAALV
EHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
YGDKQGPLHGMLINTPYVTKDLLQSKRFQAQTLGTTYIYDIPEMFRQSLIKLWESMSAQA
FLPAPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPEGRDIIVI
GNDITYRIGSFGPQEDVLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVD
PDDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGS
GMIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAAALNKVLGR
EVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVLTVLHWLSYMPKNVHSPVPLLNSKDPID
RIIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGG
IPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPL
MVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTI
NPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIRLAERLGTPELSPAE
RKELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLR
RLLLEDLVKKKIHAANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTE
EDGFRSVVDENIKYISRDYILKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILST
MDSPST
NT seq 7041 nt NT seq  +upstreamnt  +downstreamnt
atggatgagtcttctcccttgaccaagcctctggaactgaaccagcactctcgattcata
attggctctgtatctgaagataactcggaggatgagatcagcaacttggtgaaactggac
ctgctggaagagaaagaaggatcttcttcaccagcttctgtcaactcagatacactccct
gacttgggactcccaagtctacaggatggcttggccttacatataaggtccagcatgtct
ggcctacacttggtaaagcaaggccgagaccgaaagaagatagactctcaaagagatttc
actgttgcttctccagcagagtttgttactcgttttgggggaaataaagtgattgaaaag
gttctcattgccaataatggcattgctgcagtgaaatgcatgagatctatccgtaggtgg
tcttatgagatgtttagaaatgaacgtgcaattcgatttgttgtcatggtgacgcctgaa
gatcttaaagcaaatgcagagtacattaagatggcagatcactatgtcccagtgcctgga
ggaccaaacaacaacaactatgcaaatgtggaactaattcttgatattgctaaaaggatc
ccagtgcaagctgtatgggctggatggggccatgcttctgaaaatcccaagcttcctgaa
ctcctcttaaagaatggcattgcctttatgggccctccaagccaagccatgtgggctctg
ggggataagattgcctcttctatagtagctcaaacggcaggtatccctactcttccctgg
agtggtagtggtcttcgtatggactggcaagagagtgatttttcaaagcgcattttgaat
gttcctcaggatctatatgagaaaggttatgtgaaggatgttgatgctgggttgcaggca
gctgaggaagttggttatccagttatgatcaaggcttcagaaggaggaggaggaaaggga
atcagaaaagtgaacaatgctgatgactttcctaacctcttcagacaggttcaagctgaa
gttcctgggtcccctatctttgtgatgagattagccaaacagtctcgtcacttggaggtg
caaatcttagcagatcagtatggcaatgcaatctctttgtttggtcgggactgctctgtg
cagcgaaggcaccagaagatcatagaagaggctcctgccactattgcaactccagcggta
tttgagcatatggaacagtgtgctgtgaaacttgccaagatggtaggttatgtcagtgct
gggactgtggagtacctctacagccaggatggcagcttctacttcttggagctgaatccg
cggctgcaggtggagcacccttgtacggagatggtggctgatgtcaaccttccagcggca
caactccagattgccatgggtattcctctgtacagaattaaggatatccgaatgatgtat
ggagtctcaccttggggagatgtccccattgattttgaaaactctgctcatgtcccatcc
ccgaggggccacgtcattgctgctcggatcactagtgagaatcctgatgagggttttaag
cccagctcaggaacagttcaggaattgaatttccgcagcaataagaatgtatggggatat
ttcagtgttgctgcagcaggtggacttcacgaatttgcagattctcagtttggtcactgc
ttctcctggggagaaaaccgagaggaagccatttcaaacatggtagtggctctgaaggag
ctgtctatccggggagacttccggactactgtcgagtacctgatcaagctgctggagaca
gagagcttccagcataaccgcattgatacgggctggctggacaggctgattgctgagaaa
gtgcaggcagagcgtcctgataccatgttgggggttgtatgtggggctctacatgtggca
gatgtgagccttcggaacagtgtctccaatttccttcactcattagagaggggtcaggtc
cttcctgctcacacacttctgaacacagttgatgttgagcttatatatgaaggagccaag
tatgtgctgaaggtgacccgacagtcccctaactcctatgtggtgatcatgaatggttcc
tgtgtagaggtagatgtgcaccgtctgagtgatggaggattacttttgtcctatgatgga
agtagttatacaacctacatgaaggaagaagtggatagataccgcatcacaattggcaat
aagacctgtgtatttgaaaaggagaatgacccatctgtactccgttcaccttctgctgga
aagttgatccaatatattgtggaggatggaggccatgtgtttgctggccagtgctatgct
gagattgaggtgatgaagatggtaatgacactaatagctgttgaatctggttgtatccac
tatgtcaagcggcctggagcagcccttgaccctggttgtgtgattgccaagttgcagctg
gataatcccagtaaggttcagcaggctgagctacacactggaagtttgccaaagatccag
agtacagcactcagaggcgagaaacttcatcgggtcttccattacgtcctagataacctg
gtcaacgttatgaatggttactgccttccagaccctttctttaacagcaaggtaaaagat
tgggtggagaggttgatgaaaaccctcagagatccctcccttcctctcctagaattgcag
gacattatgaccagtgtttcaggccgtataccccccaatgtggagaagtccatcaagaag
gaaatggcccagtatgccagcaatatcacttctgtcctttgccagtttcccagccagcag
attgccaatatcctagatagtcacgcagctacattgaaccggaagtctgaacgcgaagtc
ttcttcatgaacactcaaagtattgtgcagctcgtgcagaggtaccgaagtggcatcaga
gggcacatgaaggctgtggtaatggatctgctccgacagtacttgagagtggagactcaa
ttccagaatggtcactatgataagtgtgtcttcacccttcgggaagagaacaaaagtgat
atgaatactgtgttgaactatatcttctcccatgcccaggtcaccaagaagaaccttctg
gtcaccatgcttattgatcaattatgtggccgtgatccaacccttacggatgagttactg
aatatccttacagaactgactcagctcagcaaaaccaccaatgccaaagtggcacttcga
gcccggcaggttctcattgcctcccatttaccatcctatgaacttcgccataaccaagta
gagtctatttttctatcggctattgacatgtatggacatcaattttgcattgagaaccta
cagaaacttatcttgtctgaaacctccatttttgatgtcctcccaaacttcttctaccat
agcaaccaggtagtgagaatggcagctctggaggtatatgtacgaagggcttacattgct
tatgaactcaacagtgtccaacatcgccaactaaaggataatacctgcgtggtagagttc
cagttcatgttgcccacatctcacccgaacagagggaacatccccacgctaaacagaatg
tccttctcctccaacctcaaccactatggcatggctcacgtagccagtgtcagtgatgtg
ctactagacaactcattcactccaccgtgccaaaggatgggcgggatggtttctttccgg
acttttgaagactttgtcagaatttttgatgaagtaatgggctgcttctgtgactcccca
ccacaaagccctacattccccgaggcagggcacacttcgctgtatgatgaagacaaggct
gccagggatgaaccaattcacatcctgaatgtggctatcaagactgactgtgacattgag
gatgacagactagcagccatgtttagagatttcactcagcaaaataaagctgctcttgtt
gaacatgggatccggcggcttacattcctggttgcacaaaaggatttcagaaaacaggtc
aactatgaggtggatcaacgatttcatagagagtttcctaaatttttcacattccgagca
agggataagtttgaagaagatcgcatctatcgtcacttggaacctgccctggctttccaa
ctagagctgaaccgaatgaggaattttgacctcactgctattccatgtgccaatcataag
atgcatttatatcttggggcagccaaagtggaagtgggtactgaagtgacagactacaga
ttttttgtaagagcaatcatcaggcattcagatttggtcaccaaggaagcctcttttgag
tatctgcagaatgagggggagcgtctgctcctggaagccatggatgagttggaggttgct
tttaacaataccaatgtccgaactgattgcaaccatatcttcctcaactttgtgcccaca
gtcatcatggacccatcaaagattgaggagtctgtgaggagcatggtgatgcgctatgga
agccggctgtggaaactccgagttctccaagcagagctgaaaattaacatccgcttaaca
ccaactggaaaagcaattcccatccgcctcttcctgaccaatgagtctggctattatttg
gacatcagtctgtacaaggaagtgactgactctaggacagcacagatcatgttccaggca
tatggagacaaacagggtccactacatgggatgctgatcaatactccttatgtgaccaaa
gacttgctacaatccaagagattccaggcacaaaccttagggacaacatatatttatgat
attcctgagatgttccggcagtctcttatcaaactctgggaatctatgtcagcccaagca
ttcctaccagccccaccactgccttctgatatgctaacttacactgaattggtgttggat
gatcaaggtcagctggtacatatgaacaggcttccaggaggaaacgagataggcatggtg
gcttggaaaatgacactcaagagtcccgagtacccagaaggaagagatatcattgttatt
ggaaatgatatcacctatcgaattgggtcctttggacctcaagaagatgtgttatttctg
agggcttctgagcttgccagggcagagggtatccctcgcatttatgtggctgctaatagt
ggagcaagaattgggttggcagaggaaatacgtcacatgttccatgtggcctgggtagat
cctgatgatccttacaagggatacaagtatctttatctgactcctcaagattataagagg
gtcagcgccttgaactctgttcactgtgaacatgtggaagatgaaggggaatccaggtat
aagattacagatattattgggaaggaagaaggacttggagctgagaacctcaggggttct
gggatgattgctggggaatcctcattggcatatgatgagatcatcactatcagcctggta
acttgccgggccattggaattggagcttatctagtccgattaggacagagaaccatccag
gttgagaactcccatttgattctgacgggagcagcagccctcaacaaagtgcttgggcgg
gaagtatatacatctaataaccagcttggaggcatccagattatgcacaacaatggagtg
acgcacagtactgtatgtgatgactttgaaggagttcttacggtcctacattggctgtcc
tatatgcccaagaatgtgcacagtccagttcctctccttaactccaaggatcctattgat
agaatcatcgaatttgtccctacaaaggccccctacgatccccgctggatgttggcagga
cgtcctcacccaacccagaaaggtcagtggctgagtggcttctttgactatggctccttc
tctgagatcatgcagccttgggcacagactgttgtggttggtagagcccggctgggtgga
atacctgtaggagttgttgccgtagaaaccagaacagtggagctcagtatcccagctgat
cctgccaacctggactctgaggccaagataattcaacaagcaggacaggtttggtttcca
gactctgcttttaagacctatcaggccatcaaggacttcaaccgagaagggcttcctctc
atggtctttgccaactggagaggcttctctggtggaatgaaagacatgtatgatcaagtt
ttgaagtttggagcgtatatcgtggatggtttacgtgaatgttctcaaccagtgatggtt
tatatccctccccaagctgagctccgtggagggtcttgggttgttattgatcctaccatt
aatccccggcatatggaaatgtatgctgaccgggaaagcagaggatctgttctggagcca
gaggggacagtagaaatcaaattccgcagaaaggatttggtgaaaactatgcgtcgggtg
gacccagtctacatccgcctggccgagcgattgggcaccccagagctaagcccagctgag
cggaaggagttggagagcaagctaaaggaacgggaggaattcctcattcccatttaccac
caggtagccgtgcagtttgctgacttgcatgacacaccaggccggatgcaggaaaagggt
gtcattaatgacattctagattggaaaacatcccgcaccttcttctactggcgtctgagg
cggctactcttggaggacttggtgaagaagaagatccacgcagccaacccagaactgacg
gacggccagatccaggccatgctcaggcgctggtttgtggaggtggagggtacagtgaag
gcctatgtctgggacaacaacaaggacctggtggagtggctggagaagcaactgacagag
gaagacggttttcgttcagtggttgatgaaaacataaagtacatttcaagagattacatc
ctcaagcagatccgaagcttggtgcaggccaaccctgaggttgccatggattccatcgtc
cacatgacccagcacatctctcctactcagcgggcagaagtggttcggattctctccacg
atggactctccttcaacgtag

DBGET integrated database retrieval system