KEGG   Sarcophilus harrisii (Tasmanian devil): 100934159Help
Entry
100934159         CDS       T02286                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100934159 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100934159 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100934159 (COMT)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     100934159 (COMT)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100934159 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 212 aa AA seqDB search
MSKEERILNWVKQRATAGDPESVLGAIDQYCYQKEWAMNVGDTKGLIVDKVVEEVKPKVL
LELGTYCGYSAVRMGRLLPPGGHLFTIEFNESFAAIAQQIIQLAGLQEKISILKGPTEEI
IPQLKKKYEINTVDMVFLDHWKDRYLPDTRLLEESGLLRKGSVLLADNVILPGAPEFLQY
IRNHKGFECTHYPSMLEYLPMKDGLEKAVFLG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaggagaggatcctgaactgggtcaagcagcgggcgactgcgggcgacccc
gagagcgtgctgggtgccatcgaccagtactgctaccagaaggagtgggccatgaacgtg
ggcgataccaaagggctgatcgtggacaaggtggtggaggaagtgaagcccaaggtcctg
ctggagctgggaacctactgcggctactcggccgtgaggatgggccgcctgctgcccccc
ggcgggcacctcttcaccatcgagttcaatgagagcttcgcggccatcgcccagcagatc
atccagctggccggcctgcaagagaagatttccatcctgaaagggcccacagaggaaatc
atcccccagctcaaaaagaagtacgagatcaatacggtcgatatggtcttcctggaccac
tggaaggaccgttaccttccggacaccaggctgctggaggagagcggcctgcttcggaag
ggctcggtgctcctggccgacaacgtcatcctccccggggcgcccgaatttctccagtac
atccggaaccacaaaggctttgagtgcacccactacccctccatgctggagtacctgccc
atgaaggacggattggagaaggccgtgttcctgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system