KEGG   Sarcophilus harrisii (Tasmanian devil): 100934183Help
Entry
100934183         CDS       T02286                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase, cAMP-dependent, catalytic, beta
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 398 aa AA seqDB search
MAARRGLPCNQCTGTTTTLQKLEGFASRLFHRQPKGAAHDLKTDLENESLHFSEYTALWD
RSMRDFLSKAKEEFLRKWENPTQTTAALEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYAFKDNSNLYMVMEYVPGGEMFSHL
RKIGRFSEPHARFYASQIVLTFEYLHALDLVYRDLKPENLLIDKYGYILVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMTAGYPPFFADQPIQIYEKIIS
GKVRFPSHFSSELKDLLRNLLQVDLTKRFGNLKNGVGDIKHHRWFSAIDWIAIFQRKVEA
PFVPRYRGAGDTSNFDDYEEEDIRVSLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaggagggggctgccttgtaaccagtgtacagggactaccaccactcttcaa
aaacttgaaggttttgctagccgattgtttcatagacagcctaagggtgcagctcatgat
ttgaaaacagatctggaaaatgagagccttcatttctctgaatacactgccttatgggac
agatcaatgagagacttcctgtccaaggccaaggaagaattcttgaggaaatgggaaaat
cccacccagactactgctgctctggaggactttgagagaaagaaaactcttggaactgga
tcatttggacgtgtcatgcttgtgaaacacaaggctactgaacagtattatgctatgaaa
atccttgataagcagaaggttgttaagctgaagcagattgagcataccttgaatgagaaa
aggatccttcaggctgtgaattttcctttcctggtcaagctggaatatgctttcaaggac
aattctaacctgtacatggttatggaatatgtgcccggtggtgagatgttttcccacctg
agaaagattggccgattcagcgagccccatgcccgcttctatgcctcccagattgttctg
acttttgagtatcttcatgctcttgacctggtctatcgtgacctgaagcctgaaaatctt
ctgattgacaaatatggatacatcctggtcactgactttggattcgccaaaagggtgaag
ggcagaacctggaccctttgtggaacccctgaatacttggctcctgagatcatcctcagc
aagggatacaacaaggccgtggactggtgggccctgggagtgctgatctatgagatgacc
gctggttatcctcccttctttgctgaccagcccatccagatctacgaaaagatcatttcc
ggaaaggtccgtttcccctcccacttcagctccgaactcaaggaccttctgaggaacctg
ctccaggttgacctgactaagcgtttcgggaacctgaagaatggtgttggtgacatcaag
caccaccgttggttttctgccattgactggattgccatttttcagagaaaagtggaagcg
ccattcgttccccgctaccgaggtgctggcgataccagcaacttcgatgattacgaagaa
gaggacatccgtgtctctcttaccgagaaatgtgcgaaggaattcgctgatttttaa

DBGET integrated database retrieval system