KEGG   Sarcophilus harrisii (Tasmanian devil): 100934204Help
Entry
100934204         CDS       T02286                                 

Gene name
ASNS
Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100934204 (ASNS)
Enzymes [BR:shr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100934204 (ASNS)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C44
   100934204 (ASNS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 295 aa AA seqDB search
MCGIWALFGSDEGLSAQYLSAMSVAHRGPDAFRFENVHGFTNCCFGFHRLAVVDPVSGMQ
PLRLQKFPSLWLCYNGEIYNHRQVGSEEGPGHIPGGWGHVPARLPPTRDWGGVQPSRGDG
FSFCLXXXANRKVFLGRDTFGVRPLFKALTDEGFLAVCSEAKGLVNLKHPAAPQLQITPF
PPGHYEVLDLKTNGKVVSVELVKFHQCRDPPLHALYDPLEKLSSGLDLETVKGNIRLLFD
RAVRKRLMTDRRIGCLLSGEGAPSAEEAQEESERLLKELYLFDVLRADRTTAAHG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatctgggcgctgttcggcagcgatgagggcctgtcggcgcaatacctgagc
gccatgagcgtcgcccaccggggccccgacgcttttcgcttcgagaatgtgcacggcttc
accaactgctgcttcggcttccaccggctggccgtggtggaccccgtgtccggcatgcag
cccctccgcctgcagaagttcccctccctgtggctgtgctacaacggcgagatctacaac
caccggcaggtggggagtgaggaggggcccgggcatatcccggggggctggggtcacgtt
ccggctcgccttcccccgacccgggattgggggggggttcagccctcccggggagacggc
ttcagtttttgcctnnnnnnnnnngccaaccgcaaggtgttcttggggagggacacgttt
ggcgtccggccgctgtttaaagcgctgacggatgaaggatttctggccgtgtgctctgaa
gccaaaggcctggtcaacctgaagcaccccgcggccccccagctgcagatcacccctttc
ccccccggccattacgaagtcctggacttgaagaccaacgggaaggtggtgtctgtggag
ctggtgaagttccaccagtgccgggacccccccctccacgcgctctacgaccccctggag
aagctctcctcaggcctggatcttgaaacagtgaagggcaacatccggctgctcttcgac
cgcgcggttcgcaagcgcctgatgacggaccggcgcatcgggtgcctcctgtcaggtgaa
ggggcaccctcggccgaggaggcccaggaggagagtgagaggcttctgaaggagctctac
ctctttgacgtcctgcgcgccgaccggaccacagcggcgcatgggtaa

DBGET integrated database retrieval system