KEGG   Sarcophilus harrisii (Tasmanian devil): 100934205Help
Entry
100934205         CDS       T02286                                 

Definition
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 356 aa AA seqDB search
MAPVTGGLGLLIFGVRSESVRGSFPSGSALLPLPRYIQSLMDLVEFHEKSPEDHKALSDF
VDALIKVRNRHHDVVPTMAQGIIEYKDSGAVDPVTNQNLQYFLDRFYMNRISTRMLMNQH
ILIFSDSKTGNPTHIGSIDPQCDVVAVVQDAYESARMLCDQYYLVSPELKLTQVNGKVPD
QPIHIVYVPSHLHHMLFELFKNAMRATVEHQESQPSLTPIEVTVVLGNEDLTIKISDRGG
GVPLRIIDRLFSYTYTTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGY
GTDAIIYLKALSSESIEKLPVFNKSAFKHYQAGPEAGDWCTPSKEPRNLAKEKVAM
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagtaacaggggggcttgggctgctgatctttggggtccgctcagagagtgtc
cgaggcagcttccccagtgggtcggcactcttgccgctcccaaggtacatccagagcctc
atggacttggtggagttccacgagaagagcccggaggatcacaaggctctgtctgacttt
gtagatgcgctgatcaaggtccggaaccggcaccacgacgtggttcccaccatggcccag
ggcatcatcgagtacaaggactcgggcgctgtcgacccggtcaccaaccagaacctgcag
tacttcctggacaggttctacatgaaccgcatctccacccgaatgctcatgaaccagcac
attctcatatttagcgattcgaagacgggaaaccccacgcacatcggaagcatcgacccc
cagtgtgatgtggttgctgtggtccaagatgcctacgagagtgcccgcatgctctgtgac
cagtattacctcgtttctcctgaactgaagctaacccaagtgaacggaaaggtacctgac
cagcccattcatatcgtctatgtcccctcacaccttcaccacatgctgtttgagctcttt
aagaatgccatgagggccacggtggagcaccaggaaagccagccctcgctcacgcccatt
gaggtcactgttgttctgggaaacgaagatctgaccatcaagatttcagaccgagggggc
ggggttccactgaggatcatcgaccgtctcttcagctacacctacacgacggcccccacc
cccgtgatggataactccaggaatgctcctttggctggttttgggtacggcttgccgatt
tcccgtctctacgccaagtactttcaaggggacctgaatctctattcgttgtcgggttac
ggaacggacgcaatcatctacttaaaggccctgtcttccgagtccatagaaaagctgcct
gtgttcaacaagtcggccttcaaacattaccaggccggcccggaggcaggggactggtgc
accccgagcaaggagcccaggaatctcgccaaggagaaggtggccatgtga

DBGET integrated database retrieval system