KEGG   Sarcophilus harrisii (Tasmanian devil): 100934311Help
Entry
100934311         CDS       T02286                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr04015  Rap1 signaling pathway
shr04020  Calcium signaling pathway
shr04022  cGMP-PKG signaling pathway
shr04062  Chemokine signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04072  Phospholipase D signaling pathway
shr04261  Adrenergic signaling in cardiomyocytes
shr04270  Vascular smooth muscle contraction
shr04310  Wnt signaling pathway
shr04371  Apelin signaling pathway
shr04540  Gap junction
shr04611  Platelet activation
shr04621  NOD-like receptor signaling pathway
shr04713  Circadian entrainment
shr04720  Long-term potentiation
shr04723  Retrograde endocannabinoid signaling
shr04724  Glutamatergic synapse
shr04725  Cholinergic synapse
shr04726  Serotonergic synapse
shr04728  Dopaminergic synapse
shr04730  Long-term depression
shr04750  Inflammatory mediator regulation of TRP channels
shr04911  Insulin secretion
shr04912  GnRH signaling pathway
shr04915  Estrogen signaling pathway
shr04916  Melanogenesis
shr04918  Thyroid hormone synthesis
shr04919  Thyroid hormone signaling pathway
shr04921  Oxytocin signaling pathway
shr04922  Glucagon signaling pathway
shr04924  Renin secretion
shr04925  Aldosterone synthesis and secretion
shr04926  Relaxin signaling pathway
shr04927  Cortisol synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04934  Cushing's syndrome
shr04961  Endocrine and other factor-regulated calcium reabsorption
shr04970  Salivary secretion
shr04971  Gastric acid secretion
shr04972  Pancreatic secretion
shr05010  Alzheimer's disease
shr05016  Huntington's disease
shr05142  Chagas disease (American trypanosomiasis)
shr05143  African trypanosomiasis
shr05146  Amoebiasis
shr05200  Pathways in cancer
Module
shr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100934311 (PLCB1)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100934311 (PLCB1)
   04310 Wnt signaling pathway
    100934311 (PLCB1)
   04371 Apelin signaling pathway
    100934311 (PLCB1)
   04020 Calcium signaling pathway
    100934311 (PLCB1)
   04070 Phosphatidylinositol signaling system
    100934311 (PLCB1)
   04072 Phospholipase D signaling pathway
    100934311 (PLCB1)
   04071 Sphingolipid signaling pathway
    100934311 (PLCB1)
   04022 cGMP - PKG signaling pathway
    100934311 (PLCB1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100934311 (PLCB1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100934311 (PLCB1)
   04621 NOD-like receptor signaling pathway
    100934311 (PLCB1)
   04062 Chemokine signaling pathway
    100934311 (PLCB1)
  Endocrine system
   04911 Insulin secretion
    100934311 (PLCB1)
   04922 Glucagon signaling pathway
    100934311 (PLCB1)
   04912 GnRH signaling pathway
    100934311 (PLCB1)
   04915 Estrogen signaling pathway
    100934311 (PLCB1)
   04921 Oxytocin signaling pathway
    100934311 (PLCB1)
   04926 Relaxin signaling pathway
    100934311 (PLCB1)
   04918 Thyroid hormone synthesis
    100934311 (PLCB1)
   04919 Thyroid hormone signaling pathway
    100934311 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100934311 (PLCB1)
   04916 Melanogenesis
    100934311 (PLCB1)
   04924 Renin secretion
    100934311 (PLCB1)
   04925 Aldosterone synthesis and secretion
    100934311 (PLCB1)
   04927 Cortisol synthesis and secretion
    100934311 (PLCB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100934311 (PLCB1)
   04270 Vascular smooth muscle contraction
    100934311 (PLCB1)
  Digestive system
   04970 Salivary secretion
    100934311 (PLCB1)
   04971 Gastric acid secretion
    100934311 (PLCB1)
   04972 Pancreatic secretion
    100934311 (PLCB1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100934311 (PLCB1)
  Nervous system
   04724 Glutamatergic synapse
    100934311 (PLCB1)
   04725 Cholinergic synapse
    100934311 (PLCB1)
   04728 Dopaminergic synapse
    100934311 (PLCB1)
   04726 Serotonergic synapse
    100934311 (PLCB1)
   04720 Long-term potentiation
    100934311 (PLCB1)
   04730 Long-term depression
    100934311 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    100934311 (PLCB1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100934311 (PLCB1)
  Environmental adaptation
   04713 Circadian entrainment
    100934311 (PLCB1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100934311 (PLCB1)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100934311 (PLCB1)
   05016 Huntington's disease
    100934311 (PLCB1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100934311 (PLCB1)
   04934 Cushing's syndrome
    100934311 (PLCB1)
  Infectious diseases
   05146 Amoebiasis
    100934311 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    100934311 (PLCB1)
   05143 African trypanosomiasis
    100934311 (PLCB1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100934311 (PLCB1)
Membrane trafficking [BR:shr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100934311 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100934311 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 100934311
NCBI-ProteinID: XP_023350652
Ensembl: ENSSHAG00000015582
Position
1
AA seq 1172 aa AA seqDB search
MAGAQPGVHALQLKPVSVSDNLKKGIKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKEWTDEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPE
GRIPLKNIYRMFSADRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEID
NIFSEFGAKSRPYLTVDQMMEFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAK
KGQISVDGFMRYLSGEENGVVPPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSV
EMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPYP
ILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKN
KKKSHKSSEGSAKKKLSEQASNTYSDSSSVFEPSSPGAGEADMESDDDDDDDDDCKKSSM
DEGTAGSEAMATEEMSNLVNYIQPVKFESFETSKKRNKSFEMSSFVETKGLEQLTKSPVE
FVEYNKMQLSRIYPKGTRVDSSNYMPQVFWNAGCQMVALNFQTVDLAMQLNLGMYEYNGK
SGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEIDMFGLP
VDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQ
AIRPGYHYICLRNERNQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAK
QLAALTLEDEEEVKKEADLGETPTESKSEPRPAPAENGVNHTTSLTPKPPSQVVHNQPAP
GSVKAPAKTEDLIQSVLTDVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLI
KEHTTKYNEIQNDYLRRRTVLEKNAKKDSKKKSEPSSPDHGSSTMEQDLAALDAEMTQKL
VELKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEK
KELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEDAQSKRQEKLL
EKHKEIRQQILDEKPKMQVELDQEYQDKFKRLPLEILEFVQEAMKGKISEEGNHSSASSS
LTSDSSKVNHKSPPNEEELEEDNAEKVFDTSL
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggccggggcacagccaggagttcacgctttgcaactcaaacctgtcagtgtctccgac
aacctgaagaaaggcatcaaatttgtcaaatgggatgatgactccactattgttactcca
attattctgaggactgatccacaaggatttttcttttattggacagatcaaaataaggag
actgaactcttagatcttagccttgtcaaggatgccagatgtgggaaacatgccaaagcc
ccaaaggaatggacagatgaggttttcagtttggcaactaacctgctggcacaaaacatg
tctagagacgcatttctggaaaaagcctataccaaactcaagctacaggtcactcctgaa
ggacgaattcctctcaaaaacatctatcgcatgttttcagcagaccgaaaacgagttgaa
actgctttagaagcttgtagtcttccatcttcaaggaatgattcaatacctcaagaagac
ttcactccagaagtatatagagttttcttaaacaacctttgccctcgacctgaaattgat
aacatcttttctgaatttggtgccaagagtagaccatatcttactgttgatcaaatgatg
gagtttatcaatttaaagcaacgagatccccgactgaatgaaatcctttatccaccatta
aaacaggaacaagtccaagtgctaattgagaaatatgaaccaaacaactccttagcaaaa
aaaggacagatctcagtagatggattcatgcgctatctgagtggagaagaaaatggagtt
gttccacctgagaaactggatttgaatgaagatatgtctcagccactctcccattatttc
attaattcttcacataacacctacctcacagctggccagctagctggcaactcctcagta
gagatgtatcgccaagtcctcttgtctggctgtcgctgtgtggagctggactgctggaag
ggaagaacagctgaagaggagcctgtaattacccatggtttcactatgacaacagaaatc
tcttttaaggaggtgatagaagctattgccgagtgtgcatttaagacatcaccataccca
atcctcctttcttttgaaaatcatgtggattctcctaaacagcaagccaagatggcagaa
tactgcagactaatatttggagatgcactgcttatggagccattagaaaaatatccactt
gaatctggagttcctcttccaagccctatggacttaatgtataaaattttggtaaaaaac
aaaaagaaatcacacaagtcttcagaaggaagtgccaaaaagaagttatcagagcaggca
tccaatacttacagtgattcatccagtgtgtttgaaccttcatctcctggagcaggagaa
gcagacatggagagtgatgatgatgatgacgatgatgatgactgtaaaaagtcttcaatg
gatgagggcactgctggtagtgaagccatggccacagaagaaatgtctaacctggtaaac
tatatacagccagtgaaatttgagtcatttgagacatcaaagaaaagaaacaaaagtttt
gaaatgtcttcttttgtggaaaccaaaggacttgagcaactaacaaagtctccagtagaa
tttgtagaatataacaaaatgcagcttagcaggatttatccaaagggaacacgtgtggat
tcttcaaattacatgccccaagttttctggaatgctggttgtcaaatggtagctcttaac
ttccaaacagtagacttggctatgcaattgaacttggggatgtatgaatacaatgggaaa
agtggttacagactaaagccagaatttatgagacgaccagacaagcattttgatccattt
actgaaggtatcgtggatggtatagtagccaatactttatctgttaagatcatttcaggt
cagtttctttctgataaaaaagttgggacttacgtagaaatagatatgtttggcttacct
gtggacaccaggagaaaagcctttaagaccaagacatctcaaggaaatgctgtaaatcca
gtctgggaagaagaacctatagtgttcaagaaggtggtcctaccttctctggcctgttta
aggatagcagcatatgaagaaggaggtaaatttattggtcaccggatattgcctgtacaa
gcaattcgaccaggctatcactacatttgtctgaggaatgaaaggaatcaacctttgatg
cttccagcagtctttgtatacatagaggtgaaagactatgtgccagatacatatgcagat
gtaattgaagcattgtcaaatcctattcgatatgtgaacctgatggagcaaagagctaag
cagctagcagcactaactctagaagatgaagaagaagtaaagaaagaggctgatcttggg
gaaacaccaacagaatctaagagtgaacccagaccagcaccagcagagaatggagtcaat
cacactacatcactgacaccaaaaccaccatctcaagttgtccacaatcaaccagcccca
ggttcagttaaagcacctgcaaaaactgaagatcttattcagagtgtcttaacagatgtg
gaagcccagacaattgaggaactaaagcagcagaagtcttttgttaaacttcagaagaaa
cattacaaagaaatgaaggacctcgtgaaaagacaccacaagaaaaccactgacctcatc
aaagagcacaccacaaagtacaatgagatccaaaatgattacttacgaaggaggactgtc
ctagaaaaaaacgccaaaaaggacagtaaaaagaaatctgaacccagcagccctgatcat
ggttcttcaacaatggagcaggaccttgctgccctggatgcagaaatgacacagaaattg
gtagaattaaaggacaagcaacagcagcagctattgaatctgcggcaggaacagtattac
agtgaaaaataccagaaacgagaacatatcaaattgcttattcagaaattgacagatgtt
gcagaagaatgccagaacaatcagttaaagaaactgaaagaaatctgtgagaaagaaaag
aaagaattgaagaagaaaatggataaaaaaagacaggagaagataacagaagcaaaatcg
aaagacaagagccaaatggaagaggagaagactgaaatgatccggtcatacatccaagaa
gtggtgcagtacataaagagactagaagatgcccaaagcaaaaggcaagagaaactttta
gagaaacacaaggagatccgtcaacagatactggatgaaaaaccaaagatgcaggtggaa
cttgaccaggaatatcaagacaaattcaaaaggctccccctggaaattctggagtttgta
caggaagccatgaaaggaaagatcagtgaagaaggcaatcacagttcagcctcttcttcc
ctcacctcagatagcagcaaagtgaaccacaagtctcccccaaatgaggaagaactagaa
gaagacaatgcagaaaaagtgtttgatacatccctttaa

DBGET integrated database retrieval system