KEGG   Sarcophilus harrisii (Tasmanian devil): 100934330Help
Entry
100934330         CDS       T02286                                 

Gene name
MAPK3
Definition
mitogen-activated protein kinase 3
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Gap junction
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Aldosterone-regulated sodium reabsorption
Alzheimer's disease
Prion diseases
Alcoholism
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100934330 (MAPK3)
   04015 Rap1 signaling pathway
    100934330 (MAPK3)
   04010 MAPK signaling pathway
    100934330 (MAPK3)
   04012 ErbB signaling pathway
    100934330 (MAPK3)
   04350 TGF-beta signaling pathway
    100934330 (MAPK3)
   04370 VEGF signaling pathway
    100934330 (MAPK3)
   04668 TNF signaling pathway
    100934330 (MAPK3)
   04066 HIF-1 signaling pathway
    100934330 (MAPK3)
   04068 FoxO signaling pathway
    100934330 (MAPK3)
   04022 cGMP - PKG signaling pathway
    100934330 (MAPK3)
   04151 PI3K-Akt signaling pathway
    100934330 (MAPK3)
   04150 mTOR signaling pathway
    100934330 (MAPK3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100934330 (MAPK3)
  Cell growth and death
   04114 Oocyte meiosis
    100934330 (MAPK3)
  Cell communication
   04510 Focal adhesion
    100934330 (MAPK3)
   04520 Adherens junction
    100934330 (MAPK3)
   04540 Gap junction
    100934330 (MAPK3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100934330 (MAPK3)
   04620 Toll-like receptor signaling pathway
    100934330 (MAPK3)
   04621 NOD-like receptor signaling pathway
    100934330 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    100934330 (MAPK3)
   04660 T cell receptor signaling pathway
    100934330 (MAPK3)
   04662 B cell receptor signaling pathway
    100934330 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    100934330 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    100934330 (MAPK3)
   04062 Chemokine signaling pathway
    100934330 (MAPK3)
  Endocrine system
   04910 Insulin signaling pathway
    100934330 (MAPK3)
   04912 GnRH signaling pathway
    100934330 (MAPK3)
   04915 Estrogen signaling pathway
    100934330 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    100934330 (MAPK3)
   04917 Prolactin signaling pathway
    100934330 (MAPK3)
   04921 Oxytocin signaling pathway
    100934330 (MAPK3)
   04919 Thyroid hormone signaling pathway
    100934330 (MAPK3)
   04916 Melanogenesis
    100934330 (MAPK3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100934330 (MAPK3)
   04270 Vascular smooth muscle contraction
    100934330 (MAPK3)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100934330 (MAPK3)
  Nervous system
   04724 Glutamatergic synapse
    100934330 (MAPK3)
   04725 Cholinergic synapse
    100934330 (MAPK3)
   04726 Serotonergic synapse
    100934330 (MAPK3)
   04720 Long-term potentiation
    100934330 (MAPK3)
   04730 Long-term depression
    100934330 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    100934330 (MAPK3)
   04722 Neurotrophin signaling pathway
    100934330 (MAPK3)
  Development
   04320 Dorso-ventral axis formation
    100934330 (MAPK3)
   04360 Axon guidance
    100934330 (MAPK3)
   04380 Osteoclast differentiation
    100934330 (MAPK3)
  Environmental adaptation
   04713 Circadian entrainment
    100934330 (MAPK3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100934330 (MAPK3)
   05205 Proteoglycans in cancer
    100934330 (MAPK3)
   05203 Viral carcinogenesis
    100934330 (MAPK3)
   05210 Colorectal cancer
    100934330 (MAPK3)
   05212 Pancreatic cancer
    100934330 (MAPK3)
   05214 Glioma
    100934330 (MAPK3)
   05216 Thyroid cancer
    100934330 (MAPK3)
   05221 Acute myeloid leukemia
    100934330 (MAPK3)
   05220 Chronic myeloid leukemia
    100934330 (MAPK3)
   05218 Melanoma
    100934330 (MAPK3)
   05211 Renal cell carcinoma
    100934330 (MAPK3)
   05219 Bladder cancer
    100934330 (MAPK3)
   05215 Prostate cancer
    100934330 (MAPK3)
   05213 Endometrial cancer
    100934330 (MAPK3)
   05223 Non-small cell lung cancer
    100934330 (MAPK3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100934330 (MAPK3)
   05020 Prion diseases
    100934330 (MAPK3)
  Substance dependence
   05034 Alcoholism
    100934330 (MAPK3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100934330 (MAPK3)
  Infectious diseases
   05132 Salmonella infection
    100934330 (MAPK3)
   05133 Pertussis
    100934330 (MAPK3)
   05152 Tuberculosis
    100934330 (MAPK3)
   05164 Influenza A
    100934330 (MAPK3)
   05161 Hepatitis B
    100934330 (MAPK3)
   05160 Hepatitis C
    100934330 (MAPK3)
   05145 Toxoplasmosis
    100934330 (MAPK3)
   05140 Leishmaniasis
    100934330 (MAPK3)
   05142 Chagas disease (American trypanosomiasis)
    100934330 (MAPK3)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100934330 (MAPK3)
Protein kinases [BR:shr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100934330 (MAPK3)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100934330 (MAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 350 aa AA seqDB search
MVKGQPFDVGPRYTELQYLGEGADGMVSSAFDHVRKARVAIKKISPFEHQTYCQRTLREI
QILLRCHHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQ
ILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRW
YRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQDDL
NCIINMKARNYLQSLPSKPKVPWVKLFPKADSKALDLLDRMLTFNPNKRITVEDALAHPY
LEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGAPGAP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagggccagccgtttgacgtgggaccgcgctacacagagctgcagtaccttggg
gagggggcggacggcatggtcagctctgcttttgaccatgttcgaaaggctcgagtagcc
atcaaaaagatcagcccgtttgagcaccagacatattgccagcgcacccttcgggagatt
cagatcctgcttcgttgccaccacgagaatgtcattggcatccgtgacatccttcgagca
cccacgctggaagccatgagggatgtttacattgttcaggacctgatggaaacagacttg
tataagctgctcaagagccagcagctgagtaatgaccatgtctgctacttcctgtaccaa
atcctacggggcctcaaatatattcactcagccaatgtgcttcatcgggacctcaaaccc
tccaatctgctcatcaacaccacttgtgacctcaagatctgtgactttggcctggcccga
attgctgaccctgagcacgatcatacaggcttcctgactgagtatgtggctacgcgatgg
tatagagcaccagagatcatgctcaattctaagggctataccaaatctattgatatctgg
tctgtgggctgtatcctcgcagaaatgctttccaatcggcccatcttccctgggaagcac
tacctggatcagctgaaccacattctaggtatcctaggttctccgtcccaggatgatctg
aattgtatcatcaacatgaaggctcggaactacctacagtcacttccatccaaacctaag
gtgccctgggtcaagctgtttcccaaagcagactccaaagccctggacctgctggaccgg
atgttgacctttaaccctaacaagcgaatcacagtggaggatgccctggcccacccctac
ttggagcagtactatgatccaactgatgagccagtggcagaagaaccctttacttttgac
atggagttggatgacctgccaaaggaacgactgaaggaactcatcttccaagagacagcc
cgattccaacctggagccccaggagccccctga

DBGET integrated database retrieval system