KEGG   Sarcophilus harrisii (Tasmanian devil): 100934342Help
Entry
100934342         CDS       T02286                                 

Gene name
ART1
Definition
(RefSeq) ADP-ribosyltransferase 1
  KO
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100934342 (ART1)
Cellular antigens [BR:shr04090]
 Proteins
  100934342 (ART1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:shr00537]
 Enzymes
  100934342 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 326 aa AA seqDB search
MQAHAVPSLLLTIFLLVELPKAWSRRVSRRDLLSRESPLDMSPASFDDQYAGCAAAMEAV
LPDLNRTEFSASPVYAEAWKSAAARWQERRDWELKGPPSSRQLPPPGFRDEHAVALLAYT
ANSPLHREFNAAVREAGRSRAYYLRYFPFKTLHFLLTEALRLLRSGQKPRCYQVFRGVHG
VRFRPLGPGATVRLGAFASASLMDAAAHQFGEDTFFGIWTCHGVAIKGYSFFPGEEEVLI
PPYETFLVVNASVPARGPVRIYLKAQDKASTFNCEYIKEKQCTSGRCKQNNSAAAVRIEP
FSPSQQYLPLLWLLTMLISLDPPNLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcccacgcagtcccatccctgttgctgaccatcttcctcctagtggagctccca
aaggcttggagccgccgggtctcccgccgcgacctcctgtctcgagagtcccccctggac
atgtctccagcctccttcgacgaccagtacgcaggctgtgcagcagctatggaggccgtc
ctcccggacctcaaccgcaccgagttcagtgccagccccgtctacgccgaagcctggaag
tcagcagccgcccgctggcaggagcgccgggactgggagctgaagggccccccttcttct
cggcaactgccgccgccgggcttcagggacgagcatgccgtggccctcctggcctacacg
gccaatagccccctgcatcgagagttcaatgcggcggtgagggaggcgggcaggtctcgg
gcttattacctgcgatattttccttttaagacgcttcacttcctgctcacagaggctctg
aggctgctgcgctcgggccagaagcccaggtgctatcaggtcttccggggtgtgcatggg
gtccgcttccgaccgctggggccgggggccaccgttcgcctgggggcctttgcctccgct
tccctgatggatgccgccgcccaccagttcggagaggacaccttctttggcatctggact
tgccacggagtggctataaagggctattccttcttccccggagaggaggaggtcctcatt
cctccctatgagactttccttgtggtcaatgcctcggtgccggcccggggtccggtccgt
atctacctcaaagcccaggacaaggccagcacctttaactgcgagtatatcaaagagaag
cagtgcacttcaggacgctgcaaacaaaataattcagcagcagcagtgaggatagagccc
ttctccccatctcagcagtacctgcctctgctctggctcctcaccatgttgatatctctt
gaccctccgaacctcctctga

DBGET integrated database retrieval system