KEGG   Sarcophilus harrisii (Tasmanian devil): 100934583Help
Entry
100934583         CDS       T02286                                 

Gene name
COMP
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100934583 (COMP)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100934583 (COMP)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100934583 (COMP)
  Cellular commiunity
   04510 Focal adhesion
    100934583 (COMP)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100934583 (COMP)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100934583 (COMP)
  Exosomal proteins of colorectal cancer cells
   100934583 (COMP)
  Exosomal proteins of bladder cancer cells
   100934583 (COMP)
Heparan sulfate/heparin binding proteins [BR:shr00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100934583 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 769 aa AA seqDB search
MGWRELRVSEARNGEGSASPEAVPETPTLQDPGAAPVAAMPLSPSRGLLLAFVCHLVSGQ
RQAPVGGDVAPQMLREMKETNLVLQEVRELLKQQIKEITFLKNTVMECDACGMQPVSSPW
TSVRPQRSCEPDSCFPGVTCTETPGGGFRCGPCPPGYSGNGYHCTDVNECNAHPCYPRVR
CINTSPGFRCEACPPGYSGPAHEGVGLAFAKANKQVCTDINECETGQHNCVPNSMCTNTR
GSFQCGPCKPGFVGDQASGCRRKTQRMCPNGEPSPCHENADCILERDGSTSCVCAVGWAG
NGLVCGKDTDLDGFPDEKLRCPDRKCRKDNCLKVPNSGQEDVDKDGIGDACDPDADGDGI
LNEQLDITDIRNSQKLELSFLHFRMHGIRNAADNCPRTPNPDQRDSDRDGVGDACDNCPQ
KGNADQKDVDHDLVGDACDSDQDQDGDGHQDSRDNCPTVPNSSQQDTDKDGLGDACDDDD
DNDGVPDSHPPGPDNCRLVPNPNQEDADGDGVGDACQGDFDADKVVDKIDVCPENAEVTL
TDFRAFQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHV
NTLTDDDYAGLIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGE
QLRNALWHTGDTNDQVKLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVAD
SNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETYRLQHN
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgggatggagggaactccgggtcagcgaggcccgaaacggagagggcagcgcgtccccc
gaggcagtgccagagacccccactctccaggacccgggcgcggccccagtcgcagccatg
cccttatctccctcccgtggactgctgctcgccttcgtctgccacctcgtcagcggtcag
agacaggcgccagtggggggagacgtggcgccccagatgcttcgggagatgaaagagacc
aatttggtactgcaggaggtgcgggaacttctcaagcagcagattaaagaaatcaccttc
ctgaagaatacggtgatggagtgtgatgcttgtggcatgcagcccgtgagtagcccgtgg
acgagcgtgcggccgcagagaagctgcgagcccgactcctgcttccccggcgtcacctgc
accgagaccccgggcggcggcttccgctgtgggccctgtcctccgggctactcgggtaac
ggataccactgcacggacgtgaacgagtgtaacgcgcatccctgctacccccgggtccgc
tgcatcaacaccagcccgggattccgctgtgaagcctgccctcccgggtacagcgggccc
gcccacgagggcgtgggcttggcttttgccaaggccaacaagcaggtttgcactgacatc
aatgagtgtgagactggccagcacaactgtgtccccaactctatgtgcaccaatactcgg
ggatccttccagtgcgggccctgcaagccagggtttgtgggagatcaggcctctggctgc
cggaggaaaacccaacggatgtgtcctaatggggagcccagtccctgtcatgaaaatgct
gattgtatcctggagagggacggctctacgtcatgtgtgtgtgctgtgggctgggctggc
aatgggctcgtttgtggtaaggacaccgacctggacggctttccggacgaaaagctgagg
tgcccggataggaagtgccgaaaggataactgcctaaaggtgcccaactcgggccaagag
gatgtggacaaagacggcatcggggacgcctgtgacccagacgcggatggggacgggatc
ctgaacgagcagttagatattacggatattaggaacagccaaaagttggagttgagcttc
ctgcactttaggatgcacgggatccggaacgctgccgacaactgtccccggacccccaat
ccagaccagcgggacagtgatagagacggggtgggagacgcctgtgataactgtccacaa
aaaggcaatgctgaccagaaagatgtggatcacgacctggtaggggacgcctgcgacagt
gaccaggaccaagacggggatggtcaccaggactctcgggacaactgccccaccgtgccc
aatagctcccagcaggacaccgacaaggacgggctgggcgatgcctgtgatgacgacgac
gacaatgatggagtcccagacagccaccccccggggccggacaattgtcgcctcgtcccc
aacccgaaccaggaggatgctgatggcgacggcgtgggcgacgcctgtcagggcgatttc
gatgcggacaaggtcgtggacaagatcgacgtgtgccccgagaacgcagaagtcaccctc
acggacttccgcgccttccagacggtggtcttagatccagaaggagatgcgcagatagac
cccaactgggtggtcctcaaccaggggatggagatcgtgcagacaatgaacagcgacccc
gggctggctgtgggctacacggccttcaacggcgtggacttcgaaggcacgttccacgtg
aacacgctcacggacgatgactacgcgggcctcatcttcggctaccaggacagctccagc
ttttacgtggtcatgtggaagcagatggaacagacctactggcaggcgaatcccttccga
gccgtggctgaacccggcatccagctcaaggcggtgaagtcatccacaggccccggagag
cagctgcggaacgccctgtggcacacaggggacaccaacgaccaggtgaagctcctctgg
aaggaccccagaaatgtgggctggaaggacaagacgtcctatcggtggttcctgcagcac
cggccgcaagtgggctacatccgggtccgcttttatgagggtcctgagcttgtggccgac
agtaacgtggtactggacacaaccatgcgaggaggccgtctcggcgtcttctgcttttcc
caggaaaacatcatctgggccaatctccgttaccgatgtaatgacacgattccagaggac
tatgagacctatcgcctacaacataactga

DBGET integrated database retrieval system