KEGG   Sarcophilus harrisii (Tasmanian devil): 100934583Help
Entry
100934583         CDS       T02286                                 

Gene name
COMP
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:shr04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:shr04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:shr04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:shr04510]
Human Diseases; Infectious diseases; Malaria [PATH:shr05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 769 aa AA seqDB search
MGWRELRVSEARNGEGSASPEAVPETPTLQDPGAAPVAAMPLSPSRGLLLAFVCHLVSGQ
RQAPVGGDVAPQMLREMKETNLVLQEVRELLKQQIKEITFLKNTVMECDACGMQPVSSPW
TSVRPQRSCEPDSCFPGVTCTETPGGGFRCGPCPPGYSGNGYHCTDVNECNAHPCYPRVR
CINTSPGFRCEACPPGYSGPAHEGVGLAFAKANKQVCTDINECETGQHNCVPNSMCTNTR
GSFQCGPCKPGFVGDQASGCRRKTQRMCPNGEPSPCHENADCILERDGSTSCVCAVGWAG
NGLVCGKDTDLDGFPDEKLRCPDRKCRKDNCLKVPNSGQEDVDKDGIGDACDPDADGDGI
LNEQLDITDIRNSQKLELSFLHFRMHGIRNAADNCPRTPNPDQRDSDRDGVGDACDNCPQ
KGNADQKDVDHDLVGDACDSDQDQDGDGHQDSRDNCPTVPNSSQQDTDKDGLGDACDDDD
DNDGVPDSHPPGPDNCRLVPNPNQEDADGDGVGDACQGDFDADKVVDKIDVCPENAEVTL
TDFRAFQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHV
NTLTDDDYAGLIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGE
QLRNALWHTGDTNDQVKLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVAD
SNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETYRLQHN
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgggatggagggaactccgggtcagcgaggcccgaaacggagagggcagcgcgtccccc
gaggcagtgccagagacccccactctccaggacccgggcgcggccccagtcgcagccatg
cccttatctccctcccgtggactgctgctcgccttcgtctgccacctcgtcagcggtcag
agacaggcgccagtggggggagacgtggcgccccagatgcttcgggagatgaaagagacc
aatttggtactgcaggaggtgcgggaacttctcaagcagcagattaaagaaatcaccttc
ctgaagaatacggtgatggagtgtgatgcttgtggcatgcagcccgtgagtagcccgtgg
acgagcgtgcggccgcagagaagctgcgagcccgactcctgcttccccggcgtcacctgc
accgagaccccgggcggcggcttccgctgtgggccctgtcctccgggctactcgggtaac
ggataccactgcacggacgtgaacgagtgtaacgcgcatccctgctacccccgggtccgc
tgcatcaacaccagcccgggattccgctgtgaagcctgccctcccgggtacagcgggccc
gcccacgagggcgtgggcttggcttttgccaaggccaacaagcaggtttgcactgacatc
aatgagtgtgagactggccagcacaactgtgtccccaactctatgtgcaccaatactcgg
ggatccttccagtgcgggccctgcaagccagggtttgtgggagatcaggcctctggctgc
cggaggaaaacccaacggatgtgtcctaatggggagcccagtccctgtcatgaaaatgct
gattgtatcctggagagggacggctctacgtcatgtgtgtgtgctgtgggctgggctggc
aatgggctcgtttgtggtaaggacaccgacctggacggctttccggacgaaaagctgagg
tgcccggataggaagtgccgaaaggataactgcctaaaggtgcccaactcgggccaagag
gatgtggacaaagacggcatcggggacgcctgtgacccagacgcggatggggacgggatc
ctgaacgagcagttagatattacggatattaggaacagccaaaagttggagttgagcttc
ctgcactttaggatgcacgggatccggaacgctgccgacaactgtccccggacccccaat
ccagaccagcgggacagtgatagagacggggtgggagacgcctgtgataactgtccacaa
aaaggcaatgctgaccagaaagatgtggatcacgacctggtaggggacgcctgcgacagt
gaccaggaccaagacggggatggtcaccaggactctcgggacaactgccccaccgtgccc
aatagctcccagcaggacaccgacaaggacgggctgggcgatgcctgtgatgacgacgac
gacaatgatggagtcccagacagccaccccccggggccggacaattgtcgcctcgtcccc
aacccgaaccaggaggatgctgatggcgacggcgtgggcgacgcctgtcagggcgatttc
gatgcggacaaggtcgtggacaagatcgacgtgtgccccgagaacgcagaagtcaccctc
acggacttccgcgccttccagacggtggtcttagatccagaaggagatgcgcagatagac
cccaactgggtggtcctcaaccaggggatggagatcgtgcagacaatgaacagcgacccc
gggctggctgtgggctacacggccttcaacggcgtggacttcgaaggcacgttccacgtg
aacacgctcacggacgatgactacgcgggcctcatcttcggctaccaggacagctccagc
ttttacgtggtcatgtggaagcagatggaacagacctactggcaggcgaatcccttccga
gccgtggctgaacccggcatccagctcaaggcggtgaagtcatccacaggccccggagag
cagctgcggaacgccctgtggcacacaggggacaccaacgaccaggtgaagctcctctgg
aaggaccccagaaatgtgggctggaaggacaagacgtcctatcggtggttcctgcagcac
cggccgcaagtgggctacatccgggtccgcttttatgagggtcctgagcttgtggccgac
agtaacgtggtactggacacaaccatgcgaggaggccgtctcggcgtcttctgcttttcc
caggaaaacatcatctgggccaatctccgttaccgatgtaatgacacgattccagaggac
tatgagacctatcgcctacaacataactga

DBGET integrated database retrieval system