KEGG   Sarcophilus harrisii (Tasmanian devil): 100934625Help
Entry
100934625         CDS       T02286                                 

Gene name
AGL
Definition
(RefSeq) glycogen debranching enzyme
  KO
K01196  glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100934625 (AGL)
Enzymes [BR:shr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100934625 (AGL)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     100934625 (AGL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: hDGE_amylase GDE_C hGDE_central Alpha-amylase DUF3836
Motif
Other DBs
NCBI-GeneID: 100934625
NCBI-ProteinID: XP_023359164
Position
4
AA seq 1377 aa AA seqDB search
MIHFTPLQTLGLSRSCYSLANQLELNPDFSTPNKQYTWNDVGQLVEKMKKEWNVLCITDV
VYNHTAANSKWLQEHPECAYNLVNSPHLKPAWILDRALWHLACDVSEGKYKEKGLPALIE
NDQQMNCIRKIVWEDIYPKIQLWEFFQVDVNKAVQQFRALLTQENRKTITKSDPKQLLKI
IQDPEYKRLGCTVDMNIALATFIPHNSGPAAIDECCNWFRKRIEELNAEKLRQINYHQEQ
AVNCILGNVFYERLAGHGPKLGPVTRKHPLVTRYFTFPFGEMTLAEEETLINRPDKSCFF
MAHNGWVMGDDPLRNFAEPGSEVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEI
TATYFQGVRLDNCHSTPLHVAEYMLDAARKLQPNLYVVAELFTGSEELDNIFVTRLGISS
LIREAMSAYNSHEEGRLVYRYGGEPVGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHR
SEYDALPSSTIVSMACCASGSTRGYDELVPHQISVVSEERFYTKWNPGASPSNASEVNLQ
SGIIAARRAINKLHQELGAKGFIQVYVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPK
TSFYSKEVPQMCIPGKIEEVVLEARTIERNTSPYRKDENSLNGMPNITVELKEHIQLNES
KIVKQTGVAKKGPNEYVQEIEFENLTPGSVIIFRVSLDPHAQVAVGILRNHLTQFNPHFK
TGSLPVDNADPILKIPFVSIASKLTLADLNQILYRCESEEQEDGGGCYNIPNWSPLKYGG
LQGLMSVLAEIRPKNDLGHPFCNNLRSGDWMIDYVSNRLISRSGAIAEVGKWLQAMFFYL
KQIPRYLIPCYFDAILIGAYTTLLDVAWNQMSSFVQNGSTFVKHLSLGSVQMCGIGKFPS
LPLLSPSLPDVPYRLNEVTGEKEQCCVSLAAGLPHFSSGLFRCWGRDTFIALRGILLITG
RYLEARNIILAFAGTLRHGLIPNLLGEGTYARFNCRDAVWWWLQCIQDYCKIAPNGTDIL
KCPVSRMYPTDDSPPLPAGTLDQPLYEVIQEAMQRHLQGIQFRERNAGPQIDRNMKDEGF
NITAGVDDQTGFVFGGNRFNCGTWMDKMGESDRARNRGIPATPRDGSAVEIVGLSKSAVR
WLLELSKRNLFPYHAVTVKRNGKDVKISYEEWNRKIQDHFEKMFHVSEDPSDPNEKRPDL
VHKRGIYKDSYGASSPWCDYQLRPNFTIAMVVAPELFTPKKAWKALEIAEKKLLGTLGMK
TLDPDDMVYCGVYDNSLDNDNYNLAKGFNYHQGPEWLWPVGYFLRAKLYFSKLMGQEAYS
QTVFLVKNVLSRHYVHLERSPWKGLPELTNENGQYCSFSCETQAWSIAATLEILFDL
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atgattcattttaccccacttcagacattggggctatctaggtcatgttattcattggca
aatcagttggaactgaatcctgacttttctacacctaataagcagtatacttggaatgat
gttggacagctagtagaaaaaatgaaaaaggaatggaacgttctttgtataactgatgtt
gtctacaatcatactgctgctaacagtaaatggctccaggaacatccagaatgtgcatat
aatctggtgaattctccacacttgaagccagcttggatcctggacagggcactttggcac
ttagcctgtgatgtttcagaaggaaaatacaaagaaaaaggactacctgctttgattgaa
aatgaccagcagatgaattgtattcgaaaaatagtttgggaggatatttacccaaaaatt
caactttgggaattttttcaagtggatgttaacaaagcagtacaacaatttagagccctt
cttacacaagaaaacaggaaaacaataacaaaatctgacccaaagcagcttcttaaaatt
attcaggacccagaatacaaacgacttggttgtactgtagatatgaatattgctttggct
actttcataccacataacagtggaccagctgcaattgacgagtgctgcaactggttccgt
aaaagaattgaggaattaaatgcagagaaacttcgtcaaataaactatcatcaagaacag
gcagttaattgtattttgggaaatgtgttttatgaacgactggctggccatggtcctaaa
ctaggtcctgttactagaaaacatcctttagttaccagatactttaccttcccatttgga
gaaatgacacttgcagaagaagaaacattaattaatcggccagataaaagttgtttcttc
atggcacataatggctgggtaatgggagatgatcctcttcgaaactttgctgaaccaggt
tcagaagtttatctgaggagagagctcatttgctggggtgacagtgttaagttacgctat
ggaaataaaccagaagactgtccatacctttgggctcacatgaaaaaatatactgaaata
actgctacctatttccagggagtacgccttgataactgccactcaacacctctccacgta
gctgagtatatgcttgatgctgctaggaaattacagcccaatttgtatgtagtggctgag
ctgttcacaggaagtgaggagctggacaatatctttgtgactagactgggcattagctcc
ttaataagagaggcaatgagtgcttataatagtcatgaagagggcagactagtttaccga
tatggaggagaacctgttggatcctttgttcagccatgtttgagacctttaatgcctgct
attgcacatgctctgttcatggatattacacatgataatgagtgccctattgtgcatcgg
tcagaatatgatgctctcccaagctccacaattgtttccatggcttgttgtgctagtgga
agtactagaggctatgatgaattagtacctcatcagatttctgtagtgtctgaagaacgg
ttttatactaagtggaatcctggtgcatctccatcaaatgcaagtgaagttaacctacaa
agtggaattattgctgcaagacgagccattaataaattacaccaagagcttggagctaaa
ggttttattcaggtgtatgttgatcaagttgatgaagacatagtggcagtaacaagacac
tctcctagtatccatcagtctgtagtggctgtgtctcgaactgcattcaggaatcctaag
acatcattttatagcaaagaagttccccaaatgtgcatcccaggaaaaattgaagaagtt
gttcttgaggctagaactattgaaagaaatacaagtccatatagaaaagatgagaattca
ctcaatgggatgccaaatatcactgtagagctcaaagaacatatccagcttaatgaaagt
aaaattgtgaagcaaactggagttgccaaaaaaggtcctaatgaatatgttcaagaaata
gaatttgaaaacttgactccaggaagtgttattatattcagagttagtcttgatcctcat
gcacaagtggctgttggcattcttcgaaatcatttgacacagtttaatccccattttaaa
actggaagccttcctgttgacaatgcagatcctatactaaaaattccctttgtttcaata
gcatccaaattaactttggcggatctaaaccaaatactctaccgctgtgaatcagaagaa
caagaagatggtggaggatgctataatatcccaaattggtcaccccttaagtatggagga
cttcaaggtttaatgtctgtgttagcagaaataagaccaaagaatgatttgggtcatcct
ttttgtaataacttaagatctggagattggatgattgattatgttagtaatcggctaatt
tcacgctcaggagctattgcagaagttggtaaatggttgcaagccatgttcttctactta
aaacagattccacgttatcttatcccatgttactttgatgctatattaattggtgcatat
actactcttctggatgttgcatggaatcagatgtcgagctttgtgcagaatggttcaaca
tttgtaaaacacctttcactgggctcagttcaaatgtgtggaataggaaagttcccctct
cttccccttctttccccctcacttcctgatgttccatatagactaaatgaggtaaccgga
gagaaggagcaatgctgtgtttctttagctgctggtttacctcatttttcatctggtctt
tttcgctgctggggaagagatacctttattgctcttagaggtatactactgattactgga
cgctatttggaggccaggaatataattttagcatttgctggtaccctgcggcatggactc
attcccaatctccttggtgagggaacttatgccagatttaattgccgagatgcagtgtgg
tggtggttgcaatgtattcaggattactgcaaaattgctccaaatggcacagacattctt
aagtgcccagtttccagaatgtatcctaccgatgactctccccctttgccggcaggcaca
ttggatcagccattatatgaagtaatacaagaagctatgcagcgtcacctgcagggtata
caattccgagaaagaaatgctggcccacagatagatagaaacatgaaggatgaaggattt
aatataactgcaggagtagatgatcaaacaggttttgtttttggaggaaatcgttttaat
tgtggtacctggatggataaaatgggagaaagtgacagagctcgaaacagaggaattcca
gctaccccaagagatggttctgctgtggaaattgttggactgagcaaatctgctgttcgt
tggttgctggaattgtcaaaaaggaatttgttcccttatcatgcagttacagtaaaaaga
aatggaaaagatgtaaaaatctcatatgaggagtggaacaggaaaatacaagaccacttt
gaaaagatgttccatgtttcagaggacccatcagatcctaatgaaaagcgtcctgattta
gttcacaaacgtggaatatacaaagacagttatggagcttcaagtccttggtgtgactac
caactcaggccaaatttcaccatagcaatggttgttgcccctgagctctttactccaaag
aaggcatggaaagccttggaaatagcagagaaaaagttacttggtaccttgggaatgaaa
actttggatcctgatgacatggtgtattgtggagtatatgataattccctagacaatgac
aactacaatcttgctaaaggttttaattatcatcaaggacctgaatggctgtggccagtc
ggatactttcttcgtgcaaaattatatttttctaaattaatgggccaagaagcttattca
cagacagtgtttttggttaaaaatgttctttcccgtcattacgttcatcttgagagatcc
ccttggaagggccttcctgaattgacaaatgagaatggacaatactgttctttcagctgt
gaaacacaggcttggtcaattgctgctactcttgagattcttttcgacttatag

DBGET integrated database retrieval system