KEGG   Sarcophilus harrisii (Tasmanian devil): 100934653Help
Entry
100934653         CDS       T02286                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 1B
  KO
K03259  translation initiation factor 4E
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr03013  RNA transport
shr04066  HIF-1 signaling pathway
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04211  Longevity regulating pathway
shr04910  Insulin signaling pathway
Module
shr_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100934653 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100934653 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    100934653 (EIF4E1B)
   04150 mTOR signaling pathway
    100934653 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100934653 (EIF4E1B)
  Aging
   04211 Longevity regulating pathway - mammal
    100934653 (EIF4E1B)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100934653 (EIF4E1B)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100934653 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100934653 (EIF4E1B)
Translation factors [BR:shr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100934653 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100934653
NCBI-ProteinID: XP_012408212
Ensembl: ENSSHAG00000007864
Position
1
AA seq 216 aa AA seqDB search
MATAAPTVQDLQTESQMLEESPRERKLSFVDRLEKHPLENRWALWFFKNDRNRTWRDNLH
LVTEFDTVEDFWAIYSHIQMASKLTSGCDYALFKDGIEPMWEDSRNKHGGRWLVSLAKQQ
RQSNLDRLWLETLLCLIGEAFEEYSEEVCGAVVNLRTKGDKIAIWTSEAENQPAVTFIGR
VYKERLGLSPKVVIGYQAHADTATKSNSFTKNKFVI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctacagctgctccaactgtgcaggatttgcagactgaatcccaaatgctggaggaa
tccccaagggagaggaagttgtcttttgtggaccggctagagaagcatcctctggagaac
aggtgggcattatggttcttcaagaatgacagaaacaggacttggcgggacaaccttcat
ctggtcaccgagtttgatactgtggaggacttctgggcgatttacagccacatccaaatg
gccagcaaactgacctcgggctgtgactatgcccttttcaaggatggcattgagcctatg
tgggaagatagcaggaataagcatggtggccgctggttggtcagcctggccaagcaacag
cgccaaagcaacctcgaccggctctggctagagacacttctttgcctgattggagaggcc
tttgaggaatacagtgaggaggtgtgtggggctgtggtcaatcttcgcaccaagggggat
aagatagccatctggaccagtgaggctgagaaccagccagctgtcacctttattggacgt
gtctacaaggagaggttggggctctccccgaaggttgttattggctaccaggcccatgca
gatacagccaccaagagcaactctttcaccaagaacaaatttgttatttga

DBGET integrated database retrieval system