KEGG   Sarcophilus harrisii (Tasmanian devil): 100934653Help
Entry
100934653         CDS       T02286                                 

Gene name
EIF4E1B
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100934653 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100934653 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    100934653 (EIF4E1B)
   04150 mTOR signaling pathway
    100934653 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100934653 (EIF4E1B)
Translation factors [BR:shr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100934653 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 200 aa AA seqDB search
MLEESPRERKLSFVDRLEKHPLENRWALWFFKNDRNRTWRDNLHLVTEFDTVEDFWAIYS
HIQMASKLTSGCDYALFKDGIEPMWEDSRNKHGGRWLVSLAKQQRQSNLDRLWLETLLCL
IGEAFEEYSEEVCGAVVNLRTKGDKIAIWTSEAENQPAVTFIGRVYKERLGLSPKVVIGY
QAHADTATKSNSFTKNKFVI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggaatccccaagggagaggaagttgtcttttgtggaccggctagagaagcat
cctctggagaacaggtgggcattatggttcttcaagaatgacagaaacaggacttggcgg
gacaaccttcatctggtcaccgagtttgatactgtggaggacttctgggcgatttacagc
cacatccaaatggccagcaaactgacctcgggctgtgactatgcccttttcaaggatggc
attgagcctatgtgggaagatagcaggaataagcatggtggccgctggttggtcagcctg
gccaagcaacagcgccaaagcaacctcgaccggctctggctagagacacttctttgcctg
attggagaggcctttgaggaatacagtgaggaggtgtgtggggctgtggtcaatcttcgc
accaagggggataagatagccatctggaccagtgaggctgagaaccagccagctgtcacc
tttattggacgtgtctacaaggagaggttggggctctccccgaaggttgttattggctac
caggcccatgcagatacagccaccaagagcaactctttcaccaagaacaaatttgttatt
tga

DBGET integrated database retrieval system