KEGG   Sarcophilus harrisii (Tasmanian devil): 100934749Help
Entry
100934749         CDS       T02286                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Sphingolipid signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Osteoclast differentiation
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100934749 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100934749 (TRAF2)
   04064 NF-kappa B signaling pathway
    100934749 (TRAF2)
   04668 TNF signaling pathway
    100934749 (TRAF2)
   04071 Sphingolipid signaling pathway
    100934749 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100934749 (TRAF2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100934749 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    100934749 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100934749 (TRAF2)
  Development
   04380 Osteoclast differentiation
    100934749 (TRAF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100934749 (TRAF2)
   05203 Viral carcinogenesis
    100934749 (TRAF2)
   05222 Small cell lung cancer
    100934749 (TRAF2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100934749 (TRAF2)
  Infectious diseases
   05160 Hepatitis C
    100934749 (TRAF2)
   05168 Herpes simplex infection
    100934749 (TRAF2)
   05169 Epstein-Barr virus infection
    100934749 (TRAF2)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100934749 (TRAF2)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100934749 (TRAF2)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100934749 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 469 aa AA seqDB search
MATANSTPPGSLDLLQPGFSKDILGTKLEDKYLCSACKNILRRPFQAQCGHRYCSYCLTS
IISTGPQNCAACIQEGIYEEGISILESSSAFPDNAARREVESLPAICVNDGCTWKGTIKE
YEAHDEVCPKFPLTCEGCGKKKILREKFQDHVKACGKCKGPCKFHVVGCTEMVENEKQQD
HEIQKVAEHLCMLLNFVLEARNFHGDIGPLLGQGDMGGWGNNSLTLGSEVSKSSELLERC
ETLERKTVTFENIVCVLNREVERVSMTAEACSRQHRLDQEKIETLSTKVQQLERSIGLKD
LAMADMEQKILEMEASTYDGIFIWKITDFARKRQEAMAGRSPAIFSPAFYTSKYGYKMCL
RIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVT
SSSFQRPVSDMNIASGCPLFCPVSKMESKNSYVRDDAIFIKAIVDLTGL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagcaaattctactcctccaggctctttagatttgcttcagcctggattttca
aaggatatcctaggaacaaaactagaagataaatatctctgctctgcatgcaagaacatt
ttgagaagaccatttcaagctcagtgtggacatcgttactgctcttattgtctgaccagc
atcataagcactgggcctcagaattgtgctgcctgcattcaggagggaatatatgaagaa
ggcatttctattttagaaagtagttcggcttttccagataatgctgctcgaagagaggta
gaaagcctaccagctatctgtgtcaatgatggttgcacatggaaaggcactataaaggaa
tatgaggcccatgatgaggtctgtcccaaatttcccttgacttgtgaaggttgtggtaag
aaaaaaattcttcgagaaaaatttcaggaccatgtcaaggcctgtggcaaatgcaaaggg
ccctgcaaattccatgttgttggctgtaccgaaatggtggaaaatgagaaacaacaggat
catgaaattcagaaggtggctgaacacctctgcatgttgttaaattttgtcctcgaggct
aggaacttccatggagatattggtcccctcctcggccaaggagacatggggggctgggga
aacaactcattgaccttagggtcagaggtgtccaaatcttcagagctgttggaaagatgt
gaaaccttggaaagaaaaacagtcacttttgagaacattgtctgtgtcttgaaccgggag
gtggagagagtgtccatgacagctgaagcttgcagcaggcagcatcgcctagaccaggag
aaaatcgaaactctgagtaccaaggtccagcagctggaaaggagtataggattgaaagac
ctggcaatggctgacatggaacagaagatccttgagatggaagcttctacttatgatgga
attttcatatggaagataactgactttgctaggaaacgccaggaagccatggctggtcgc
tctcctgccatcttctctccagccttctacacgagcaaatatggctataagatgtgtttg
agaatttatctgaatggggatggcactggacgtgggacccacctttctcttttctttgtc
gtgatgaaaggaccaaatgatgcacttctacgttggccctttaaccaaaaggtgacatta
atgctgctagatcagaacaaccgggaacatgtgattgatgccttcaggcctgatgtgaca
tcttcctctttccaaaggccagtcagtgatatgaacattgccagtggctgccccctcttc
tgtcctgtctccaaaatggagtcaaagaattcttatgtgcgcgatgacgccattttcatc
aaagccatcgttgatttgacgggtctttaa

DBGET integrated database retrieval system