KEGG   Sarcophilus harrisii (Tasmanian devil): 100934769Help
Entry
100934769         CDS       T02286                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 2462 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNP
HCKFHIYNGTRPSETIPAGVQLAEDELYARPPDPRSPKGWLVDLINKFGTLNGFQILHDR
FISGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDDELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAASWTNASKKQREKLLELIRRLAEDDKDGVMAHK
VLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSCSQDRDTQKIQWIDRFIEELRTNDKWV
IPALKQIREICSLFGEAPQNLSQTQRSPHVFYRHDLINQLQHNHALVTLVAENLSAYMES
MRQYAKEHGEYDPQTVRPGSRYSHVQEVQERLNFLRFLLKDGQLWLCAPQAKQIWKCLAE
NAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFENNVLQLDPSLLTENGMKCFERFFKA
VNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQGNDDIASRAIDLLKEIYTNLGPRLQV
NQVAIHEDFIQSCFDRLKASYDTLCVLDGDKDSINCARQEAIRMVRVLTVLREYINECDS
DYHEERTILPMSRAFRGKHITLVVRFPNQGRQVEDLDIWSHTNDTIGSVRRCILNRIKAN
SAHTKVELFIGGELVDPADDRKLIGQLNLKDKTLITAKLTQISSNMPSSPDSSSDSSTGS
PGNHGNHYSDGPNPEVESCLPGVIMSMHPRYISFLWQVADLGSSLNMPPLRDGARVLMKL
MPPDNTTVEKLRAICLDHAKLGESSLSPSLDSLFFGPSASQVLYLTEVVYALLMPANAPL
GEDASDFQYNFLKSGGLPLVLSMLTRNNFLPNADMETRRGAYLNALKIAKLLLTAVGYGH
VRAVAEACQPVAEGTNPMSPINQATHDQAVVLQNALQNIPNPTSECMLRNVAIRLAQQIS
DEASKYIPDICVIRAVQKIVWASGCGSVQLVFSSNDDISKIYEKTNAGNEPDMEDEHVCC
EALEVMTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSKTVRQMAQEQFFLMSTRCCMG
HRPLLFFITLLFTVLGSTARERAKHSGDYFTLLRHLLNYAYNSNINVPNAEVLLNNEIDW
LKRIRDEVKRTGETGVEETILEGHLGVTKELLAFQTPEKKYHIGCEKGGANLIKELIDDF
IFPASNVYLQYMRNGELPAEQAIPVCSSPATINAGFELLVALAVGSVRNLKQIVDTLTEM
YYIACEALTEWEYLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPAIRNGILAIEGT
GSDVDDDMSGDEKQDNESNVDPRDDVFGYPHQYEDKPALNKTEDRKEYNIGVLRHLQVIF
GHLAASRLQYYVPRGFWKQFRLWGEPVNLREQHDALEFFNSLVDSLDEALKALGHPAMLS
KVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHC
EKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPRELDMEPYTVAG
VAKLEGDDVNPENQLIQQNEQSENEPTGSTKYRLVGVLVHSGQASGGHYYSYIIQRNGGD
GEKNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYRRQKRWWNAYIL
FYERMDTIDKDNELIKYISELVVTTKPHQIKMPSAIERSVRKQNVQFMHNRMQYSLEYFQ
FVKKLLTCNSVYLNPPPGQDHLLPEAEEITMISIQLAARFLFTTGFHTKKIVRGPASDWY
DALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECPSAEVRGAFAKLIVFIAHFSLQDG
PCPSPFASPGPSSQAYDNLSLSDHLLRAVLNLLRREVSEHGRHLQQYFNLFVMYANLGMA
EKTQLLKLNVPATFMLVALDEGPGPPIKYQYAELGKLYTVVSQLIRCCNVSSRMQSSING
NPPLSNPYGDPNLSQPIMALQQNVADILFVRTSYVKKIIEDCSNSEETIKLLRFCCWENP
QFSSTVLSELLWQVAYSYTYELRPYLDLLLQILLIEDSWQTHRIHNALKGIPDDRDGLFD
TIQRSKNHYQKRAYQCIKCMVALFSNCPVAYQILQSNGDLKRKWTWAVEWLGDELERRPY
TGNPQYTYNNWSPPVQSNETSNGYFLERSHSARMTLAKACELCPEEEPDDQDAPDEHESS
PPEDAPLYPHSPGSQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGNEEVSPPQT
KD
NT seq 7389 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgacccgtggctctccagtaggagggaatgacagccagggccaggctcct
gatggacagtcccagccccccctccaacagaatcagacttcatcgcctgattcttctaat
gagaactccccagcaacaccccctgatgaacagggtcaaggtgatgccccaccccagctt
gaagatgaggaacctgcatttccccatactgacctggcaaagttggatgacatgatcaac
aggccccgatgggtggttccagttttaccaaaaggggaattagaagttcttttagaagct
gctattgatcttagtaaaaaaggtcttgatgttaaaagtgaagcatgtcaacgttttttc
cgagatgggctaacaatatctttcactaaaatccttacggatgaggcagtgagtggctgg
aagtttgaaattcataggtgtattattaacaatactcatcgcctagtagagctttgtgtg
gccaagctttcacaagactggtttccacttctagaacttcttgctatggccttaaatcct
cattgcaaattccatatatacaatggtacacgtccatctgaaacaattcctgcaggtgtt
cagttggcagaagatgaactctacgcccgtcctccagatccacgatctccaaaaggttgg
ttagtggatctcatcaataaatttggcacattaaatgggttccagattttgcacgaccgc
ttcattagtggctcagcattgaatgtccaaattattgcagctcttattaaaccatttgga
cagtgctatgagtttttgacacttcatacagtgaagaaatatttccttccaattatagaa
atggttccacagtttttagaaaacttaactgatgatgaactgaaaaaagaagcaaaaaat
gaagcaaaaaatgatgctttgtcaatgataataaaatctttgaagaatttagcttcacga
gtcccaggacaagaagaaactgtaaaaaatttagaaatatttagattaaaaatgatactt
aggttgttacaaatttcttctttcaatggcaagatgaatgcactaaatgaggttaataaa
gtgatctctagtgtgtcatattatactcatcggcatggtaatcctgaggaggaagagtgg
ctcactgcagaacgaatggcagcaagttggacaaatgcaagtaaaaaacagcgtgaaaaa
ttacttgagctaatacgtcgtcttgccgaagatgataaagatggtgtgatggcccataaa
gtgttgaacctattgtggaacttggcccatagtgatgatgtacctgttgatatcatggac
caggctctcagcgcccacattaaaatcttagattatagttgttcacaggatcgagacaca
caaaagatccaatggatagatcgttttatagaagaacttcgcacaaatgataaatgggta
attcctgcactgaaacaaattagagaaatttgtagtttatttggagaagctccacaaaat
ttgagtcaaacacagcgaagtccacatgtgttttatcgtcatgatttaatcaatcaactt
cagcacaatcatgccctagttactctggtagcagaaaatctctctgcttatatggaaagt
atgagacaatatgcaaaagagcatggagaatatgatccgcaaactgtaagaccaggaagt
agatatagtcacgtacaagaagtccaagaacgacttaatttcctaagatttttattgaag
gatggtcaactatggctatgtgctcctcaggcaaaacaaatttggaaatgtttagctgaa
aatgcggtttacctttgtgatcgtgaagcctgttttaagtggtattccaaattgatggga
gatgaaccagacctagatcctgacattaataaagacttctttgaaaataatgtgcttcag
ctcgatccttccctattaacagaaaatggaatgaaatgttttgagcgtttcttcaaagct
gtgaactgtcgagaagggaaattagtagcaaaaaggcgagcctatatgatggatgatttg
gagttaattggtttagattacctttggagggttgtgattcagggaaatgatgacattgcc
agcagagcaattgacctccttaaagagatctatactaatctcggaccaaggttgcaagtg
aatcaggtagcaatccatgaagacttcattcaatcctgctttgatcgtttgaaagcctcc
tatgatacattatgtgttttggatggtgacaaagacagtattaattgtgcaagacaggaa
gcaatacgaatggtgcgagtgttgactgttttaagggaatacataaatgaatgtgacagt
gattatcatgaagaaaggacaattctacctatgtcaagagcttttcgtggtaaacatatc
actctggtagttcgttttcctaatcaaggccggcaggtagaagacttggacatctggtct
catacaaatgacacaattggttcagtaagacgttgcattctcaatcgtattaaagctaat
agtgcccatacaaaagtagagctttttattggtggtgaactggtggatcctgcagatgat
aggaagctaattggacaactaaacctaaaagataaaacgctaattacagccaaacttaca
cagataagttccaatatgccttcaagtcctgatagttcttctgattcatcaactggttct
cctggtaaccatggaaatcattatagtgatggtcccaatccagaagtagaaagctgtttg
cctggagtgataatgtcaatgcatcccaggtatatttctttcctttggcaagttgcagac
ttgggtagcagtctaaacatgccacctctaagagatggagctagagtacttatgaaactt
atgccaccagataatactacagttgaaaaactaagagctatttgcttagatcatgcaaaa
cttggagaaagcagcctcagtccatctcttgactcacttttctttggtccctctgcctca
caagtgctatatctaacagaggtagtttatgccttgttgatgcctgccaatgcacctctg
ggtgaagatgccagtgattttcaatataatttcttaaaaagtggtggcttgcctcttgtc
ctgagcatgctaactagaaataacttcctgccaaatgcagatatggaaactcgaaggggt
gcctaccttaatgctcttaaaatcgccaaattattgctgactgccgttggctatggccat
gttcgagctgtggcagaagcttgtcaaccagttgcagaaggcacaaatcccatgtcaccg
ataaatcaggctactcatgatcaagcagtggtgctacagaatgcccttcagaacattcct
aatccaacatctgaatgtatgcttagaaatgtggcaattcgccttgcccagcagatatct
gatgaggcatcaaaatatatccctgatatttgtgtcattcgagctgtacaaaaaattgtc
tgggcatcagggtgtgggtcagtacaactggtgtttagttcaaatgatgatattagtaaa
atttatgagaagacaaatgcagggaatgaaccagacatggaagatgaacatgtttgttgt
gaagcattggaagtgatgacactatgctttgctttgattccaacagccttagatgcactt
agtaaagaaaaagcatggcagacttttattattgacttgctcttacattgtcatagcaaa
actgttcggcagatggcacaggagcaattctttttaatgtctactaggtgttgcatggga
cacagacctctacttttcttcattacgttattatttactgttttagggagtacagcaaga
gagagagctaaacattcaggagattattttactctattaaggcatcttctaaattatgct
tacaacagtaatattaatgtgcccaatgctgaagttcttctaaataatgaaattgattgg
cttaaaaggatcagggatgaagttaaaagaacaggtgaaacaggggtggaagaaacaatc
ttggaaggtcaccttggtgtaacaaaagagttattggcctttcaaactccagaaaagaaa
taccatattggttgtgaaaagggaggtgctaatcttattaaagaattgattgatgatttc
atctttcctgcatctaatgtttacttacaatatatgagaaatggagaactgccagctgag
caggccataccagtctgcagttcaccagctaccatcaatgctggttttgagttgcttgta
gcattagctgttggttctgtgagaaatctcaaacagatagtggacacattgacagagatg
tattatatagcttgtgaggcacttacagaatgggaatatctgccacctgttggacctcgt
ccaccaaagggatttgtgggtctgaaaaatgctggtgctacttgttatatgaattcagtg
atccagcagctgtacatgattcctgccatcaggaatggtattcttgcaatagagggcact
ggcagtgatgtagatgatgatatgtctggagatgagaagcaagacaatgagagtaatgtt
gatcctcgagatgatgtatttggatatcctcatcaatatgaagacaaaccagctttgaat
aaaactgaagacagaaaagaatacaatattggtgttttaagacatcttcaggtcattttt
ggtcatttagcagcttctagattgcagtattacgtaccaagaggattttggaaacaattt
aggctatggggtgaacctgttaacctacgtgagcaacatgatgcattagaattttttaat
tctttggtggatagtttagatgaagctttgaaagcattgggacatcctgctatgctaagt
aaagtcttaggaggttcctttgctgatcagaagatttgccaaggttgtccacataggtac
gagtgtgaagaatcatttacgactctgaatgtagatattagaaatcaccaaaaccttctt
gattctttggaacaatatgtcaagggagatttactggaaggtgcaaatgcatatcattgt
gaaaaatgcaacaaaaaggttgatacagtaaagcgcctcctaattaagaaattgccccca
gttcttgccattcagttaaaacgattcgactatgactgggaaagggaatgtgcaatcaag
ttcaatgattactttgaatttccacgggaattggacatggaaccttacacagtggcgggt
gttgcaaaactggaaggggatgatgtaaaccctgaaaatcagttaatacaacagaatgaa
cagtcagaaaatgagccaactggaagcacgaaatacagactggtgggtgtacttgtacac
agtggtcaagcaagtgggggacactattattcttacatcatccagaggaatggtggagat
ggtgagaaaaatcgctggtataaatttgatgatggagatgtgacagaatgtaaaatggat
gatgatgaagaaatgaaaaaccagtgttttggtggagagtacatgggtgaagtgtttgat
catatgatgaagcgtatgtcttataggcgccagaaaaggtggtggaatgcctacattctt
ttttatgaacgtatggacacaatagataaggacaatgaattaatcaaatatatttcagag
ttggttgttaccacaaaacctcaccagattaaaatgccatcagccattgaaagaagtgta
cggaagcagaatgtgcaattcatgcataaccgtatgcaatacagtttggaatatttccag
tttgtaaaaaaacttctgacatgtaacagtgtctacttaaaccctcctccagggcaagat
catctgttgcctgaagcagaagaaattactatgattagtattcagcttgctgctagattc
cttttcaccacaggatttcacacaaaaaaaatagtccgtggccctgccagtgactggtat
gatgcattgtgtattcttctccgccacagcaagaatgtacgcttttggtttgcacataat
gtcctctttaatgtttcaaatcgtttttctgagtaccttctggaatgccccagtgcagaa
gtgaggggtgcatttgcaaaacttatagtatttattgcacatttttcattgcaagatggc
ccatgtccttcaccttttgcttcacctggaccttctagtcaggcatatgataatttaagc
ttgagtgatcacttgttgagagcagtactaaatcttctcagaagggaagtttcagagcac
gggcgtcatttgcagcagtatttcaatctgtttgtaatgtatgctaatctaggtatggca
gaaaaaacacagcttttgaaactgaatgtgcctgccacatttatgcttgttgctctggat
gaaggaccaggtccgcccatcaaatatcagtatgccgagctaggcaaattatatactgta
gtgtcacagctgatccgctgttgcaatgtatcatcccggatgcagtcttcaatcaatggt
aatccccctctttccaacccctatggtgatcctaatttatctcaacctataatggcactt
cagcagaatgtggcagatattttgtttgtgagaacaagttatgtgaagaaaattattgaa
gactgcagtaactcagaagaaaccatcaaattgcttcgtttttgctgttgggagaatcct
cagttctcttctacagtcctcagtgaactactttggcaggttgcctattcatatacctat
gaactccgaccttatttggatctccttttacaaatcttattaattgaggattcctggcag
acacacagaattcataatgcacttaaaggaataccagatgatcgggatgggctgtttgat
acaattcagcgctctaaaaatcattatcagaaaagagcttatcagtgtataaaatgtatg
gtagctctctttagtaattgtcctgtagcctaccaaatcttacagagtaatggagatctg
aaaagaaagtggacctgggcagtggagtggcttggagatgaacttgagcggcgaccatat
actggcaatcctcagtatacatacaacaactggtctcctccagtccagagcaatgaaaca
tcaaatggttactttttggagagatcacatagtgctcggatgacccttgcaaaagcttgc
gaactctgtccagaggaggaaccagatgaccaagatgccccagacgaacatgaatcatct
ccaccagaagatgccccattatatccccattcacctggatctcagtatcagcagaataac
catgtgcatggacagccatatacaggcccagcagcacatcacatgaacaaccctcagaga
actggccaacgagcacaagaaaattatgaaggcaatgaagaagtttccccacctcaaaca
aaagattag

DBGET integrated database retrieval system