KEGG   Sarcophilus harrisii (Tasmanian devil): 100934794Help
Entry
100934794         CDS       T02286                                 

Gene name
POM121
Definition
(RefSeq) nuclear envelope pore membrane protein POM 121
  KO
K14316  
nuclear pore complex protein Nup121
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100934794 (POM121)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100934794 (POM121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 781 aa AA seqDB search
MICSPVTVRIARPDLPRSPLEPVMNSAVVNSPSRNTPDPCAKETVMNALKESRKRAVEED
DQIFCDAQENKRRRHDSSGSGHSAFEPLVANGAPASLVPKPGSLKRSLTSQCAEDNLNKR
SRTSSTSSLTNTTPGGIPSSIRNAITSSYSSTRGFSQLWKRSGPSTSPLSSPASSRSQTP
ERPVKKAREEELHQSSSLTPMTSDKESQAEKVTDTPTWKKQSSWSTPSTSGSGGKRKRKV
QLLPSRRGDQLTLPPPPQLGYSITAEDLDLEKKAALQWFNKVLEEKTDPPPASVAESSPA
PRPLSFTSSETATSSSAAPPAASANLLLDSLKKMQSSPNPAALTDAAGAAPAAAPSPLKP
ASPPAAPGPSEPGPPAATSVASKPVSTFSLMSPATTLAATTSSSSQAPPAPVSEGSSKPL
TSPSPKPSLLFGMLSAPPPTSSAPTPTPAPAPTPAPAPTPTSTSTPAPAPTPTPTTSSAP
SPATPMFKPIFGAPPKMESGVSPAAPPTPTPASCGSVLSTTPSSSTTTFKPIFGSMGPPS
SLPLASPFLKQPSSSAPSTAVTTAVLAPLFSGLPSAQSAAAPAPTTTAAAASTGTTDSGA
KPAFGFGLSSLAGTAGAAATATTPSATTTNTVFSFGTATTSSFGASTAGPGTSSSTTAFS
FGASQSGASSAATPFGAALNQNPLAPSSSTPFAFNVANTSENKSVFGGTSTPTFGQSAPA
PGAGTVGSSLSFGTPATPAQSFVGAGPSFGPSTPSFSIGAGSKTPGARQRLQARRQHTRK
K
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtagccctgtgactgtgaggattgctcgcccagacctaccccgatcccccctg
gagccggtcatgaattcggccgtggtgaattcaccatccagaaataccccagacccatgt
gcaaaggaaaccgtgatgaacgcactcaaagagagtcggaaaagggcggtggaggaagat
gatcaaatcttctgtgatgcccaggaaaacaagcgaaggcgccatgacagtagcgggagt
ggacactcggcatttgaacccttggtggcaaatggggccccagcatctcttgttcccaag
cctgggtctctgaagagaagcctcacgtcccagtgtgcagaagacaacttgaataagaga
tcgcgcacctcttcgaccagctctttgaccaacaccaccccggggggcatccccagctcc
atccgcaatgccatcaccagctcctacagctccaccaggggcttctcacagctgtggaag
aggagtggccccagcacctcacccctctccagccccgcttcatctcggtcccagaccccg
gagaggcctgtgaagaaagctcgagaagaagagcttcatcagtctagctctttgaccccc
atgacctcagacaaggaatcacaggcagagaaggtgaccgatacccccacatggaagaaa
cagagctcttggagcaccccatccacctccgggagtggtgggaagcgcaaacgcaaagtt
cagctgttgccttcccggcgaggagaccagctcaccctgcccccacctccccaacttggt
tactccatcacggctgaggacctggacttggaaaagaaggccgccttgcagtggtttaac
aaagtcttggaggagaagacagaccctcctcctgcttctgtggcagagagctcccctgcc
cctcggcccctttccttcacatcctcggagacggccacgtcctcgtcagccgctcctcca
gctgccagcgccaacctgctgctggacagtctgaagaagatgcagagctccccgaacccg
gcggccctcacagatgcggctggagcagcccctgctgcggctccctccccgctgaagccc
gccagcccacccgctgcccccgggccctcagagccggggcccccagcagccacctcggtg
gcatccaagcccgtctcgaccttctccttgatgagccctgccaccacactcgctgctacc
accagcagcagcagccaggcccccccagctcctgtgtccgagggctccagcaagcccctc
accagcccctcccccaagccaagccttctcttcggaatgctgagtgcccctcctccaaca
tcctccgctcccactcccactcccgctcctgctcccactcctgctcctgctcccactccc
acttctacttctactcccgctcctgctcccactcccactcctacaacttcttcagctcct
tctcctgccacccccatgttcaaacccatttttggggctccccctaagatggagagtggg
gtttcaccggcggccccccccaccccgactcctgcgtcctgtggctcagtcctctccaca
actcccagcagctccactacaaccttcaagcccatctttgggagcatgggcccaccctcc
tctctgcccttggcctcccccttcttgaagcagccttcctcttcggcccccagcacggcc
gtcaccaccgccgtgctggcgcctctctttagcggcctccccagcgcccagtccgctgcg
gcccccgcccccaccaccaccgctgctgccgcctccacagggaccactgactctggtgcc
aagcccgcctttggcttcgggctgagcagcttggctggcactgcgggcgccgccgccacg
gccaccaccccgagcgccaccaccaccaacacggtcttctcgttcggcacggccaccacc
tccagcttcggggccagcacggccggccccggaaccagctcgagcaccacagccttcagc
tttggagccagccagagcggggcgtccagtgccgccacccccttcggggctgccttgaac
cagaaccccctggccccaagctcgagcacaccctttgccttcaatgtggccaacacctct
gagaacaagtctgtgtttggaggcacctccacgcccacctttggccagagcgctccagcc
cctggagcgggcacggtgggcagtagcctttcctttgggaccccggccacgccagcccag
agctttgtgggagcagggccgtcttttggaccatcgaccccttcgttttccattggtgca
ggatccaagaccccgggggcccggcagcggctgcaggcccggaggcagcacactcgaaag
aaatag

DBGET integrated database retrieval system