KEGG   Sarcophilus harrisii (Tasmanian devil): 100934794Help
Entry
100934794         CDS       T02286                                 

Definition
(RefSeq) nuclear envelope pore membrane protein POM 121C
  KO
K14316  nuclear pore complex protein Nup121
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03013  RNA transport
Module
shr_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100934794
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100934794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: POM121
Motif
Other DBs
NCBI-GeneID: 100934794
NCBI-ProteinID: XP_023359553
Ensembl: ENSSHAG00000015124
Position
4
AA seq 1010 aa AA seqDB search
MICSPVTVRIARPDLPRSPLEPVMNSAVVNSPSRNTPDPCAKETVMNALKESRKRAVEED
DQIFCDAQENKRRRHDSSGSGHSAFEPLVANGAPASLVPKPGSLKRSLTSQCAEDNLNKR
SRTSSTSSLTNTTPGGIPSSIRNAITSSYSSTRGFSQLWKRSGPSTSPLSSPASSRSQTP
ERPVKKAREEELHQSSSLTPMTSDKESQAEKVTDTPTWKKQSSWSTPSTSGSGGKRKRKV
QLLPSRRGDQLTLPPPPQLGYSITAEDLDLEKKAALQWFNKVLEEKTDPPPASVAESSPA
PRPLSFTSSETATSSSAAPPAASANLLLDSLKKMQSSPNPAALTDAAGAAPAAAPSPLKP
ASPPAAPGPSEPGPPAATSVASKPVSTFSLMSPATTLAATTSSSSQAPPAPVSEGSSKPL
TSPSPKPSLLFGMLSAPPPTSSAPTPTPAPAPTPAPAPTPTSTSTPAPAPTPTPTTSSAP
SPATPMFKPIFGAPPKMESGVSPAAPPTPTPASCGSVLSTTPSSSTTTFKPIFGSMGPPS
SLPLASPFLKQPSSSAPSTAVTTAVLAPLFSGLPSAQSAAAPAPTTTAAAASTGTTDSGA
KPAFGFGLSSLAGTAGAAATATTPSATTTTPTPSLSQPFLFGAAPAAGSSFTPSTGSMFQ
FNKPAATTSSTAAATTANTFGAVQATPSGTGGFGFGGSVTTAALPTTSQVTLTFGPTTTT
AAFSSPFGSSIKTMPPPPYPGATPQPAFGSVDGQQQQQGATKAGPTPSFSSTFSFGGSSG
PSPALPQPTFGSAAQPAFGGAKPPTSFGAPASTQPAFGSTNTVFSFGTATTSSFGASTQT
TSSGTGSSMFSSMTLAPFTFGSSTSAASSGGFGASTAGPGTSSSTTAFSFGASQSGASSA
ATPFGAALNQNPLAPSSSTPFAFNVANTSENKSVFGGTSTPTFGQSAPAPGAGTVGSSLS
FGTPATPAQSFVGAGPSFGPSTPSFSIGAGSKTPGARQRLQARRQHTRKK
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtagccctgtgactgtgaggattgctcgcccagacctaccccgatcccccctg
gagccggtcatgaattcggccgtggtgaattcaccatccagaaataccccagacccatgt
gcaaaggaaaccgtgatgaacgcactcaaagagagtcggaaaagggcggtggaggaagat
gatcaaatcttctgtgatgcccaggaaaacaagcgaaggcgccatgacagtagcgggagt
ggacactcggcatttgaacccttggtggcaaatggggccccagcatctcttgttcccaag
cctgggtctctgaagagaagcctcacgtcccagtgtgcagaagacaacttgaataagaga
tcgcgcacctcttcgaccagctctttgaccaacaccaccccggggggcatccccagctcc
atccgcaatgccatcaccagctcctacagctccaccaggggcttctcacagctgtggaag
aggagtggccccagcacctcacccctctccagccccgcttcatctcggtcccagaccccg
gagaggcctgtgaagaaagctcgagaagaagagcttcatcagtctagctctttgaccccc
atgacctcagacaaggaatcacaggcagagaaggtgaccgatacccccacatggaagaaa
cagagctcttggagcaccccatccacctccgggagtggtgggaagcgcaaacgcaaagtt
cagctgttgccttcccggcgaggagaccagctcaccctgcccccacctccccaacttggt
tactccatcacggctgaggacctggacttggaaaagaaggccgccttgcagtggtttaac
aaagtcttggaggagaagacagaccctcctcctgcttctgtggcagagagctcccctgcc
cctcggcccctttccttcacatcctcggagacggccacgtcctcgtcagccgctcctcca
gctgccagcgccaacctgctgctggacagtctgaagaagatgcagagctccccgaacccg
gcggccctcacagatgcggctggagcagcccctgctgcggctccctccccgctgaagccc
gccagcccacccgctgcccccgggccctcagagccggggcccccagcagccacctcggtg
gcatccaagcccgtctcgaccttctccttgatgagccctgccaccacactcgctgctacc
accagcagcagcagccaggcccccccagctcctgtgtccgagggctccagcaagcccctc
accagcccctcccccaagccaagccttctcttcggaatgctgagtgcccctcctccaaca
tcctccgctcccactcccactcccgctcctgctcccactcctgctcctgctcccactccc
acttctacttctactcccgctcctgctcccactcccactcctacaacttcttcagctcct
tctcctgccacccccatgttcaaacccatttttggggctccccctaagatggagagtggg
gtttcaccggcggccccccccaccccgactcctgcgtcctgtggctcagtcctctccaca
actcccagcagctccactacaaccttcaagcccatctttgggagcatgggcccaccctcc
tctctgcccttggcctcccccttcttgaagcagccttcctcttcggcccccagcacggcc
gtcaccaccgccgtgctggcgcctctctttagcggcctccccagcgcccagtccgctgcg
gcccccgcccccaccaccaccgctgctgccgcctccacagggaccactgactctggtgcc
aagcccgcctttggcttcgggctgagcagcttggctggcactgcgggcgccgccgccacg
gccaccaccccgagcgccaccacaaccacgcccactccctccctgtcacagcctttcctc
ttcggggccgcccctgccgctggctccagcttcaccccgtccaccggctccatgttccag
tttaacaagcccgccgccaccacctccagcaccgccgccgcgaccaccgccaacaccttt
ggtgccgtgcaggcgacccccagcggcactggtggctttgggttcggcgggagcgtcacc
acggccgcgctgccgaccaccagccaagtgacgttgacgttcggccccaccaccaccact
gccgccttcagctccccctttggctcaagcatcaagaccatgccgcccccgccctaccca
ggggccaccccgcagccagcttttgggagcgtcgacgggcagcagcagcagcagggggcc
accaaggcgggccccacgccaagcttcagtagcacattcagcttcgggggctcatcaggc
cctagcccggccctcccccagcccacctttggcagcgccgcccagccggcctttggcggg
gcaaagccccctacctccttcggcgcccccgccagcacgcagccggccttcggcagcacc
aacacggtcttctcgttcggcacggccaccacctccagcttcggggccagcacgcagacc
accagcagtggcacgggcagctccatgttcagcagcatgacgctggcccccttcaccttc
gggagctccacgtctgcagccagcagtgggggcttcggggccagcacggccggccccgga
accagctcgagcaccacagccttcagctttggagccagccagagcggggcgtccagtgcc
gccacccccttcggggctgccttgaaccagaaccccctggccccaagctcgagcacaccc
tttgccttcaatgtggccaacacctctgagaacaagtctgtgtttggaggcacctccacg
cccacctttggccagagcgctccagcccctggagcgggcacggtgggcagtagcctttcc
tttgggaccccggccacgccagcccagagctttgtgggagcagggccgtcttttggacca
tcgaccccttcgttttccattggtgcaggatccaagaccccgggggcccggcagcggctg
caggcccggaggcagcacactcgaaagaaatag

DBGET integrated database retrieval system