KEGG   Sarcophilus harrisii (Tasmanian devil): 100934794Help
Entry
100934794         CDS       T02286                                 

Gene name
POM121
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:shr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100934794 (POM121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 919 aa AA seqDB search
MAAGMWGLLREVQNEGSGSLTVAKLWTGAGPEKGNKDCQVVEAPAAGAEDVTCMGGAPQP
FCGSPTLKSFQKISSPCDRRLLALRQQVDHLTAPNRFSLAPRRRYPIQQAQYSLLGTLPT
VCWEGYQRKNVLSPRNSHMICSPVTVRIARPDLPRSPLEPVMNSAVVNSPSRNTPDPCAK
ETVMNALKESRKRAVEEDDQIFCDAQENKRRRHDSSGSGHSAFEPLVANGAPASLVPKPG
SLKRSLTSQCAEDNLNKRSRTSSTSSLTNTTPGGIPSSIRNAITSSYSSTRGFSQLWKRS
GPSTSPLSSPASSRSQTPERPVKKAREEELHQSSSLTPMTSDKESQAEKVTDTPTWKKQS
SWSTPSTSGSGGKRKRKVQLLPSRRGDQLTLPPPPQLGYSITAEDLDLEKKAALQWFNKV
LEEKTDPPPASVAESSPAPRPLSFTSSETATSSSAAPPAASANLLLDSLKKMQSSPNPAA
LTDAAGAAPAAAPSPLKPASPPAAPGPSEPGPPAATSVASKPVSTFSLMSPATTLAATTS
SSSQAPPAPVSEGSSKPLTSPSPKPSLLFGMLSAPPPTSSAPTPTPAPAPTPAPAPTPTS
TSTPAPAPTPTPTTSSAPSPATPMFKPIFGAPPKMESGVSPAAPPTPTPASCGSVLSTTP
SSSTTTFKPIFGSMGPPSSLPLASPFLKQPSSSAPSTAVTTAVLAPLFSGLPSAQSAAAP
APTTTAAAASTGTTDSGAKPAFGFGLSSLAGTAGAAATATTPSFGSTNTVFSFGTATTSS
FGASTAGPGTSSSTTAFSFGASQSGASSAATPFGAALNQNPLAPSSSTPFAFNVANTSEN
KSVFGGTSTPTFGQSAPAPGAGTVGSSLSFGTPATPAQSFVGAGPSFGPSTPSFSIGAGS
KTPGARQRLQARRQHTRKK
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggaatgtgggggctactgagagaggtgcagaatgagggcagtggcagcctc
actgtcgctaagctatggactggagcaggcccagagaagggtaacaaggattgtcaggtc
gtggaagccccggctgcaggggcggaggatgtcacctgcatggggggggccccccagccg
ttctgcggctccccgactcttaaatccttccagaaaattagctcgccttgcgatcgccgg
ctcctcgccttgcgacagcaggtggaccacctgactgctccaaaccgattctcattagct
ccacggaggaggtatcccattcagcaggcacagtactccttgctggggaccctccccacc
gtgtgctgggaaggctaccagaggaaaaacgtgctctctccccgaaattctcacatgatc
tgtagccctgtgactgtgaggattgctcgcccagacctaccccgatcccccctggagccg
gtcatgaattcggccgtggtgaattcaccatccagaaataccccagacccatgtgcaaag
gaaaccgtgatgaacgcactcaaagagagtcggaaaagggcggtggaggaagatgatcaa
atcttctgtgatgcccaggaaaacaagcgaaggcgccatgacagtagcgggagtggacac
tcggcatttgaacccttggtggcaaatggggccccagcatctcttgttcccaagcctggg
tctctgaagagaagcctcacgtcccagtgtgcagaagacaacttgaataagagatcgcgc
acctcttcgaccagctctttgaccaacaccaccccggggggcatccccagctccatccgc
aatgccatcaccagctcctacagctccaccaggggcttctcacagctgtggaagaggagt
ggccccagcacctcacccctctccagccccgcttcatctcggtcccagaccccggagagg
cctgtgaagaaagctcgagaagaagagcttcatcagtctagctctttgacccccatgacc
tcagacaaggaatcacaggcagagaaggtgaccgatacccccacatggaagaaacagagc
tcttggagcaccccatccacctccgggagtggtgggaagcgcaaacgcaaagttcagctg
ttgccttcccggcgaggagaccagctcaccctgcccccacctccccaacttggttactcc
atcacggctgaggacctggacttggaaaagaaggccgccttgcagtggtttaacaaagtc
ttggaggagaagacagaccctcctcctgcttctgtggcagagagctcccctgcccctcgg
cccctttccttcacatcctcggagacggccacgtcctcgtcagccgctcctccagctgcc
agcgccaacctgctgctggacagtctgaagaagatgcagagctccccgaacccggcggcc
ctcacagatgcggctggagcagcccctgctgcggctccctccccgctgaagcccgccagc
ccacccgctgcccccgggccctcagagccggggcccccagcagccacctcggtggcatcc
aagcccgtctcgaccttctccttgatgagccctgccaccacactcgctgctaccaccagc
agcagcagccaggcccccccagctcctgtgtccgagggctccagcaagcccctcaccagc
ccctcccccaagccaagccttctcttcggaatgctgagtgcccctcctccaacatcctcc
gctcccactcccactcccgctcctgctcccactcctgctcctgctcccactcccacttct
acttctactcccgctcctgctcccactcccactcctacaacttcttcagctccttctcct
gccacccccatgttcaaacccatttttggggctccccctaagatggagagtggggtttca
ccggcggccccccccaccccgactcctgcgtcctgtggctcagtcctctccacaactccc
agcagctccactacaaccttcaagcccatctttgggagcatgggcccaccctcctctctg
cccttggcctcccccttcttgaagcagccttcctcttcggcccccagcacggccgtcacc
accgccgtgctggcgcctctctttagcggcctccccagcgcccagtccgctgcggccccc
gcccccaccaccaccgctgctgccgcctccacagggaccactgactctggtgccaagccc
gcctttggcttcgggctgagcagcttggctggcactgcgggcgccgccgccacggccacc
accccgagcttcggcagcaccaacacggtcttctcgttcggcacggccaccacctccagc
ttcggggccagcacggccggccccggaaccagctcgagcaccacagccttcagctttgga
gccagccagagcggggcgtccagtgccgccacccccttcggggctgccttgaaccagaac
cccctggccccaagctcgagcacaccctttgccttcaatgtggccaacacctctgagaac
aagtctgtgtttggaggcacctccacgcccacctttggccagagcgctccagcccctgga
gcgggcacggtgggcagtagcctttcctttgggaccccggccacgccagcccagagcttt
gtgggagcagggccgtcttttggaccatcgaccccttcgttttccattggtgcaggatcc
aagaccccgggggcccggcagcggctgcaggcccggaggcagcacactcgaaagaaatag

DBGET integrated database retrieval system