KEGG   Sarcophilus harrisii (Tasmanian devil): 100934810Help
Entry
100934810         CDS       T02286                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:shr04010]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:shr04722]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:shr05016]
Human Diseases; Substance dependence; Cocaine addiction [PATH:shr05030]
Human Diseases; Substance dependence; Alcoholism [PATH:shr05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 321 aa AA seqDB search
MDGSPSSLIPFLFSKLAGLLVRLLPPPGPSPQPEAPLSPKASDAAETDPGLPEGAGGDPV
PPDSLRAAFHQVRRVMTILFLTMVISYFGCMKAAPMKESSVRGQGGLTYPGMRTHGTLES
LNGPKAGSRGLTSLADTFEHVIEELLDEDQNVQPREESKDADLYTSRVMLSSQVPLEPPL
LFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTV
LEKVPVPKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRV
GWRFIRIDTSCVCTLTIKRGR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatggatccccgagctccttgatcccttttctcttctccaagttagctggtttgctg
gtgaggcttctacccccgccaggccctagcccccagcccgaagcgcccctgtcccccaaa
gcgtcggatgcagctgagacggaccccggcctcccagaaggggcagggggagaccccgtg
cctccggactcccttcgagctgccttccaccaggtgcgaagagtgatgaccatccttttc
cttactatggttatttcatacttcggttgcatgaaggctgcccccatgaaagaaagcagt
gtccgaggtcaaggcggcttgacctacccggggatgcggacccacggaactctggagagt
ctcaatggtcccaaggcagggtcaaggggactgacctccttggctgacaccttcgaacac
gtgatcgaggagcttctggatgaggaccagaacgttcagccgagggaggagagcaaggat
gccgacttgtacacgtctagggtcatgctcagcagccaagtgcctttggaacccccgctg
ctctttctccttgaggaatacaaaaattacctggatgcggcgaacatgtccatgagggtc
cgtcgccactccgaccctgcccgtcggggggagctgagcgtgtgtgacagtattagcgag
tgggtcacggcggccgataaaaagactgcagtggacatgtcgggtgggacggtcacggtc
ctggaaaaggtcccggtccccaaaggccaactgaagcaatacttctacgagaccaagtgt
aatcccatgggttatacgaaagaaggctgcagaggtatagacaaaaggcactggaactcc
cagtgtcgaactacccagtcctatgtgcgggcgctcaccatggataataaaaagagagtt
ggctggaggttcatcagaatagacacttcttgtgtatgtacactgaccattaaaagggga
agatag

DBGET integrated database retrieval system