KEGG   Sarcophilus harrisii (Tasmanian devil): 100934810Help
Entry
100934810         CDS       T02286                                 

Gene name
BDNF
Definition
(RefSeq) brain-derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04024  cAMP signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04722  Neurotrophin signaling pathway
shr05016  Huntington's disease
shr05030  Cocaine addiction
shr05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100934810 (BDNF)
   04010 MAPK signaling pathway
    100934810 (BDNF)
   04024 cAMP signaling pathway
    100934810 (BDNF)
   04151 PI3K-Akt signaling pathway
    100934810 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100934810 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100934810 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    100934810 (BDNF)
   05034 Alcoholism
    100934810 (BDNF)
Cytokines and growth factors [BR:shr04052]
 Growth factors
  Growth factors (RTK binding)
   100934810 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 100934810
NCBI-ProteinID: XP_023362071
Position
6
AA seq 246 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKESSVRGQGGLTYPGMRTHGTLESLNGPKAGSRGLTSLA
DTFEHVIEELLDEDQNVQPREESKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAAN
MSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVPKGQLKQYF
YETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVGWRFIRIDTSCVCTL
TIKRGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaaagcagtgtccgaggtcaaggcggcttgacctacccggggatgcggacccac
ggaactctggagagtctcaatggtcccaaggcagggtcaaggggactgacctccttggct
gacaccttcgaacacgtgatcgaggagcttctggatgaggaccagaacgttcagccgagg
gaggagagcaaggatgccgacttgtacacgtctagggtcatgctcagcagccaagtgcct
ttggaacccccgctgctctttctccttgaggaatacaaaaattacctggatgcggcgaac
atgtccatgagggtccgtcgccactccgaccctgcccgtcggggggagctgagcgtgtgt
gacagtattagcgagtgggtcacggcggccgataaaaagactgcagtggacatgtcgggt
gggacggtcacggtcctggaaaaggtcccggtccccaaaggccaactgaagcaatacttc
tacgagaccaagtgtaatcccatgggttatacgaaagaaggctgcagaggtatagacaaa
aggcactggaactcccagtgtcgaactacccagtcctatgtgcgggcgctcaccatggat
aataaaaagagagttggctggaggttcatcagaatagacacttcttgtgtatgtacactg
accattaaaaggggaagatag

DBGET integrated database retrieval system