KEGG   Sarcophilus harrisii (Tasmanian devil): 100934810Help
Entry
100934810         CDS       T02286                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100934810 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100934810 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100934810 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    100934810 (BDNF)
   05034 Alcoholism
    100934810 (BDNF)
Cytokines [BR:shr04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    100934810 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 321 aa AA seqDB search
MDGSPSSLIPFLFSKLAGLLVRLLPPPGPSPQPEAPLSPKASDAAETDPGLPEGAGGDPV
PPDSLRAAFHQVRRVMTILFLTMVISYFGCMKAAPMKESSVRGQGGLTYPGMRTHGTLES
LNGPKAGSRGLTSLADTFEHVIEELLDEDQNVQPREESKDADLYTSRVMLSSQVPLEPPL
LFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTV
LEKVPVPKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRV
GWRFIRIDTSCVCTLTIKRGR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatggatccccgagctccttgatcccttttctcttctccaagttagctggtttgctg
gtgaggcttctacccccgccaggccctagcccccagcccgaagcgcccctgtcccccaaa
gcgtcggatgcagctgagacggaccccggcctcccagaaggggcagggggagaccccgtg
cctccggactcccttcgagctgccttccaccaggtgcgaagagtgatgaccatccttttc
cttactatggttatttcatacttcggttgcatgaaggctgcccccatgaaagaaagcagt
gtccgaggtcaaggcggcttgacctacccggggatgcggacccacggaactctggagagt
ctcaatggtcccaaggcagggtcaaggggactgacctccttggctgacaccttcgaacac
gtgatcgaggagcttctggatgaggaccagaacgttcagccgagggaggagagcaaggat
gccgacttgtacacgtctagggtcatgctcagcagccaagtgcctttggaacccccgctg
ctctttctccttgaggaatacaaaaattacctggatgcggcgaacatgtccatgagggtc
cgtcgccactccgaccctgcccgtcggggggagctgagcgtgtgtgacagtattagcgag
tgggtcacggcggccgataaaaagactgcagtggacatgtcgggtgggacggtcacggtc
ctggaaaaggtcccggtccccaaaggccaactgaagcaatacttctacgagaccaagtgt
aatcccatgggttatacgaaagaaggctgcagaggtatagacaaaaggcactggaactcc
cagtgtcgaactacccagtcctatgtgcgggcgctcaccatggataataaaaagagagtt
ggctggaggttcatcagaatagacacttcttgtgtatgtacactgaccattaaaagggga
agatag

DBGET integrated database retrieval system