KEGG   Sarcophilus harrisii (Tasmanian devil): 100934924Help
Entry
100934924         CDS       T02286                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 2-like
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100934924
 Human Diseases
  Cancers
   05215 Prostate cancer
    100934924
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100934924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 252 aa AA seqDB search
MTCQLSPVLAGSAVMIGFGLLSMLSSGPSNYGKQANSLLPLATRLPARVAWFLQELPSFL
VPAGLIAWQPQPHFGLPGTLLLGLFCGHYFHRTFIYSLLTRGSPFPLKLLFPGLIFCTVN
GFLQGHYLIYCAEYPDEWFTDVRFTSGIFLFFLGMTINIHSDYLLRHLRKPGETSYKIPQ
GGLFTYISGANYFGEIVEWIGYAMATWSLPGLAFAFFSLCFLGKRAREHHRFYLKKFQDY
PKSRKAIIPFIF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatgccaattgagcccggtgctggctggcagcgctgtgatgatcggcttcgggttg
cttagtatgctgtcttccggaccctcaaactatggcaaacaggccaacagccttttgccc
ttggccacccggttgccagcccgcgtagcctggttcctccaggaactcccctctttcttg
gtgcccgctgggctgattgcctggcagccccaaccacatttcggcttgccggggacctta
ctgcttggcctcttctgcggacactacttccacagaacattcatttacagccttctcacc
agaggaagtccttttccactcaaactactttttccaggccttattttctgtaccgtgaat
ggcttccttcaaggacactatttaatttactgtgctgaataccctgatgaatggttcact
gatgtccggtttacttcaggtatctttttatttttcttgggaatgacaatcaatattcac
agtgattatttactacgccacctcagaaagcctggagaaacctcctataagattccacaa
ggaggactgttcacttacatatctggagccaactactttggtgaaatagtggaatggatt
ggctatgccatggcaacctggtcattaccaggtttggcctttgcctttttctcactatgt
tttcttggaaaacgagctcgtgagcatcacaggttctatctcaagaagtttcaggactac
cctaagtctcggaaagccatcattcctttcatattttaa

DBGET integrated database retrieval system