KEGG   Sarcophilus harrisii (Tasmanian devil): 100935041Help
Entry
100935041         CDS       T02286                                 

Gene name
USP13
Definition
(RefSeq) ubiquitin specific peptidase 13 (isopeptidase T-3)
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100935041 (USP13)
Peptidases [BR:shr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100935041 (USP13)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100935041 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 890 aa AA seqDB search
MPVNSRLTLPSETLHPNRSSLAEVLVPSEMLCLARKPLFKEPSKLNNSRETQRKFSLRNR
IGSENPSDVFRFVVEERIQCCQSRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRRE
AETCRRPLPELVRARIPFSACLQAFSEPDNVEDFWSSALQAKSAGVKTSRFASFPEYLVV
QIKKFTFGLDWVPKKFGVLLISGEIEENFQQVELLTGWISEGGLYVCMNTFLAFGREHVE
RHYRKTGQCVYMHLKRHVREKVTGASGGVLPQRRNPKLFLDLEMTGDLNSDDYEYEDEAK
LVIFPDHYEIALPNIEELPALVTIACDAVLNSKSPYRKQEPDSWENELQISKHANNLMQL
DNGVRIPPGGWKCAKCDLRENLWLNLTDGTILCGKWFFDNMGGNGHALDHYKEMGYPLAV
KLGTITPDGADVYSFQEEESVLDPHLAKHLAHFGIDMLQMHSTENGTRDNDVKPRISEWE
VIQESGMKLKPMYGSGYTGMRNLGNSCYLSVVMQAIFSIPEFQRMYVGNLARIFDYSPLD
PTQDFNTQMAKLGHGLLSGQYSKPPMKSELIEQVMKEEHKPQQNGISPCMFKAFVSKSHP
EFSSNRQQDAQEFFLHLVNLVEVNVSIDMPDLLDINHLRATGLQPGEEELPDIAPPIVIP
DDPKDRLMNHYMEPPDIDESSVMQLAEMGFPLEACRKAVYYTGNMGPEVAFNWIIGHMEE
PDFAEPLSLPGFGGSATMGATAFGAIGLDNQPPEEIVAIITSMGFQRTQAVQALKATNNN
LERALDWIFSHPELEEDNEFIAHMMEMENNANANIISESKPDGPRVKDGSGRYELFGFIS
HMGPSTMSGHYVCHIKKEGRWVIYNDHKVCASERPPKDLGYMYFYHRISS
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaacagcagactgacccttccaagtgagacactgcacccaaacaggagcagc
ctcgctgaggtccttgttccatcagagatgctctgtcttgcaagaaaaccactcttcaaa
gagccgtccaagctgaacaacagcagagaaactcaaaggaagttttctctgaggaaccga
attggctctgaaaatcccagtgatgttttccggtttgtggtggaagaacggattcagtgc
tgtcagtccaggaaagtccgctatactgagagggttgactatttgatgcaattgccagtg
gccatggaggcggcaaccaacaaggatgagcttattgcctacgagttgacaaggagagaa
gcagagacatgcaggagaccactcccagaactggtccgggccaggattccttttagcgcc
tgccttcaagccttctctgaaccggataatgtggaagatttctggagcagcgccctacaa
gcaaaatctgctggtgtgaaaacgtcccgctttgcctcattccctgagtacttggtagtg
cagataaagaaattcacatttggtcttgactgggttcccaaaaagtttggtgtcctgctg
atctcaggagaaattgaggaaaacttccagcaagttgagcttctcacagggtggatttca
gaaggaggtctctatgtgtgcatgaatacgttcctggcctttggaagggaacatgttgaa
aggcactatcggaaaactggacagtgtgtgtacatgcatctgaaaagacatgtaagagag
aaagtaacaggggcatctggtggcgtcttaccccaaaggaggaatcccaagctattctta
gatctagaaatgactggagatttaaatagcgatgattatgaatatgaagatgaagccaaa
ctcgttatatttccagaccactacgaaattgcattgccaaatatagaggagttacctgca
ctggtaacaattgcttgtgatgccgtccttaattcaaaatctccatataggaaacaggag
ccagattcctgggaaaatgagctgcagatttccaaacatgctaataacctcatgcaactg
gacaatggtgtcaggattcctcccggtggctggaagtgtgccaaatgtgacttgcgggag
aacctctggttgaatctaactgatggtaccattctttgtggaaagtggttctttgacaac
atggggggaaacgggcatgcgctggaccattacaaagaaatgggctaccctttagcagtg
aagttgggaaccatcactccagatggagcagatgtttattccttccaagaagaggagtct
gttttagatccacatttagccaaacacttagcacattttgggattgacatgcttcagatg
cattcgacggagaatggcacacgggacaatgatgtcaaacccaggatcagtgagtgggaa
gtcattcaggagtcgggaatgaagctgaagcccatgtatggctctggatacacggggatg
aggaatctgggaaacagctgctatctcagtgtggtcatgcaagccatcttcagcatccct
gaatttcagagaatgtatgtggggaacttggcaaggatatttgactactctcctctagat
ccaacacaggatttcaacacacagatggctaagttaggacatggccttctctcgggccaa
tattccaaacctcctatgaaatctgagctcattgaacaggtgatgaaagaagaacataag
cctcagcagaatgggatctcgccatgcatgttcaaggcctttgtcagcaagagccatcct
gaattctcctccaacagacagcaggatgcccaggagtttttcttgcacctggtaaatcta
gtggaggtaaatgtttccatcgatatgccagacctccttgacatcaatcatctcagagcc
acagggttacagcctggagaggaagagcttccagacatcgcccccccaatagtcattcct
gatgaccccaaagatcgattgatgaaccattatatggaaccaccagacattgatgagtcc
tctgtgatgcagctggcagagatgggtttccctctggaggcatgtcggaaagctgtgtac
tatactggaaacatgggacctgaggtggctttcaactggatcattggccatatggaagag
cctgattttgccgaaccattatctctgcctggttttggaggaagtgctactatgggggcc
actgcttttggtgctattggattggataaccagcctccagaagaaattgtagccatcatc
acctccatgggtttccagagaactcaggccgttcaggccctaaaggccacgaacaacaac
ttggagcgggccctggattggatcttcagtcaccctgaattggaagaggataatgaattc
attgcccacatgatggagatggagaacaatgcaaatgctaacattatttcagagtccaag
ccagatggtcccagagtgaaagatggatcaggaaggtatgagctctttgggttcatcagc
cacatgggaccgtccaccatgagcggccattatgtttgtcatatcaaaaaggaaggcagg
tgggtgatctacaatgaccataaagtgtgtgcctcagaaaggccccccaaagacctgggc
tacatgtacttttaccacaggatatcaagctag

DBGET integrated database retrieval system