KEGG   Sarcophilus harrisii (Tasmanian devil): 100935041Help
Entry
100935041         CDS       T02286                                 

Gene name
USP13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 890 aa AA seqDB search
MPVNSRLTLPSETLHPNRSSLAEVLVPSEMLCLARKPLFKEPSKLNNSRETQRKFSLRNR
IGSENPSDVFRFVVEERIQCCQSRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRRE
AETCRRPLPELVRARIPFSACLQAFSEPDNVEDFWSSALQAKSAGVKTSRFASFPEYLVV
QIKKFTFGLDWVPKKFGVLLISGEIEENFQQVELLTGWISEGGLYVCMNTFLAFGREHVE
RHYRKTGQCVYMHLKRHVREKVTGASGGVLPQRRNPKLFLDLEMTGDLNSDDYEYEDEAK
LVIFPDHYEIALPNIEELPALVTIACDAVLNSKSPYRKQEPDSWENELQISKHANNLMQL
DNGVRIPPGGWKCAKCDLRENLWLNLTDGTILCGKWFFDNMGGNGHALDHYKEMGYPLAV
KLGTITPDGADVYSFQEEESVLDPHLAKHLAHFGIDMLQMHSTENGTRDNDVKPRISEWE
VIQESGMKLKPMYGSGYTGMRNLGNSCYLSVVMQAIFSIPEFQRMYVGNLARIFDYSPLD
PTQDFNTQMAKLGHGLLSGQYSKPPMKSELIEQVMKEEHKPQQNGISPCMFKAFVSKSHP
EFSSNRQQDAQEFFLHLVNLVEVNVSIDMPDLLDINHLRATGLQPGEEELPDIAPPIVIP
DDPKDRLMNHYMEPPDIDESSVMQLAEMGFPLEACRKAVYYTGNMGPEVAFNWIIGHMEE
PDFAEPLSLPGFGGSATMGATAFGAIGLDNQPPEEIVAIITSMGFQRTQAVQALKATNNN
LERALDWIFSHPELEEDNEFIAHMMEMENNANANIISESKPDGPRVKDGSGRYELFGFIS
HMGPSTMSGHYVCHIKKEGRWVIYNDHKVCASERPPKDLGYMYFYHRISS
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcaacagcagactgacccttccaagtgagacactgcacccaaacaggagcagc
ctcgctgaggtccttgttccatcagagatgctctgtcttgcaagaaaaccactcttcaaa
gagccgtccaagctgaacaacagcagagaaactcaaaggaagttttctctgaggaaccga
attggctctgaaaatcccagtgatgttttccggtttgtggtggaagaacggattcagtgc
tgtcagtccaggaaagtccgctatactgagagggttgactatttgatgcaattgccagtg
gccatggaggcggcaaccaacaaggatgagcttattgcctacgagttgacaaggagagaa
gcagagacatgcaggagaccactcccagaactggtccgggccaggattccttttagcgcc
tgccttcaagccttctctgaaccggataatgtggaagatttctggagcagcgccctacaa
gcaaaatctgctggtgtgaaaacgtcccgctttgcctcattccctgagtacttggtagtg
cagataaagaaattcacatttggtcttgactgggttcccaaaaagtttggtgtcctgctg
atctcaggagaaattgaggaaaacttccagcaagttgagcttctcacagggtggatttca
gaaggaggtctctatgtgtgcatgaatacgttcctggcctttggaagggaacatgttgaa
aggcactatcggaaaactggacagtgtgtgtacatgcatctgaaaagacatgtaagagag
aaagtaacaggggcatctggtggcgtcttaccccaaaggaggaatcccaagctattctta
gatctagaaatgactggagatttaaatagcgatgattatgaatatgaagatgaagccaaa
ctcgttatatttccagaccactacgaaattgcattgccaaatatagaggagttacctgca
ctggtaacaattgcttgtgatgccgtccttaattcaaaatctccatataggaaacaggag
ccagattcctgggaaaatgagctgcagatttccaaacatgctaataacctcatgcaactg
gacaatggtgtcaggattcctcccggtggctggaagtgtgccaaatgtgacttgcgggag
aacctctggttgaatctaactgatggtaccattctttgtggaaagtggttctttgacaac
atggggggaaacgggcatgcgctggaccattacaaagaaatgggctaccctttagcagtg
aagttgggaaccatcactccagatggagcagatgtttattccttccaagaagaggagtct
gttttagatccacatttagccaaacacttagcacattttgggattgacatgcttcagatg
cattcgacggagaatggcacacgggacaatgatgtcaaacccaggatcagtgagtgggaa
gtcattcaggagtcgggaatgaagctgaagcccatgtatggctctggatacacggggatg
aggaatctgggaaacagctgctatctcagtgtggtcatgcaagccatcttcagcatccct
gaatttcagagaatgtatgtggggaacttggcaaggatatttgactactctcctctagat
ccaacacaggatttcaacacacagatggctaagttaggacatggccttctctcgggccaa
tattccaaacctcctatgaaatctgagctcattgaacaggtgatgaaagaagaacataag
cctcagcagaatgggatctcgccatgcatgttcaaggcctttgtcagcaagagccatcct
gaattctcctccaacagacagcaggatgcccaggagtttttcttgcacctggtaaatcta
gtggaggtaaatgtttccatcgatatgccagacctccttgacatcaatcatctcagagcc
acagggttacagcctggagaggaagagcttccagacatcgcccccccaatagtcattcct
gatgaccccaaagatcgattgatgaaccattatatggaaccaccagacattgatgagtcc
tctgtgatgcagctggcagagatgggtttccctctggaggcatgtcggaaagctgtgtac
tatactggaaacatgggacctgaggtggctttcaactggatcattggccatatggaagag
cctgattttgccgaaccattatctctgcctggttttggaggaagtgctactatgggggcc
actgcttttggtgctattggattggataaccagcctccagaagaaattgtagccatcatc
acctccatgggtttccagagaactcaggccgttcaggccctaaaggccacgaacaacaac
ttggagcgggccctggattggatcttcagtcaccctgaattggaagaggataatgaattc
attgcccacatgatggagatggagaacaatgcaaatgctaacattatttcagagtccaag
ccagatggtcccagagtgaaagatggatcaggaaggtatgagctctttgggttcatcagc
cacatgggaccgtccaccatgagcggccattatgtttgtcatatcaaaaaggaaggcagg
tgggtgatctacaatgaccataaagtgtgtgcctcagaaaggccccccaaagacctgggc
tacatgtacttttaccacaggatatcaagctag

DBGET integrated database retrieval system