KEGG   Sarcophilus harrisii (Tasmanian devil): 100935051Help
Entry
100935051         CDS       T02286                                 

Gene name
PFN1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100935051 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100935051 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100935051 (PFN1)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100935051 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFANITPAEVAVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLVDGEYTMDLRTKSTGGAPTFNLTVTMTAKTLVLLMGKEGIH
GGMINKKCYEMATHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggaacgcctacatcgacaacctcatggcggacgggacctgtcaggatgcg
gccatagtcggctataaggactcgccctcggtctgggccgctgtaccagggaaaaccttc
gccaatatcacgcctgctgaagtagctgtattggttggcaaagaccgttcaagtttcttc
gtaaatggtctgacactcgggggccagaaatgttctgtgatcagggattcgctactggta
gatggagaatacaccatggaccttcgtacaaagagcactgggggtgctcccaccttcaac
cttactgttaccatgactgccaagacgctagtcctgctgatggggaaagaaggtattcac
ggaggaatgatcaacaagaagtgttatgaaatggctacccatcttcgacgttctcaatac
tga

DBGET integrated database retrieval system