KEGG   Sarcophilus harrisii (Tasmanian devil): 100935150Help
Entry
100935150         CDS       T02286                                 

Gene name
REN
Definition
(RefSeq) renin
  KO
K01380  
renin [EC:3.4.23.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Renin-angiotensin system
Renin secretion
Brite
KEGG Orthology (KO) [BR:shr00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100935150 (REN)
   04614 Renin-angiotensin system
    100935150 (REN)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     100935150 (REN)
Peptidases [BR:shr01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100935150 (REN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 416 aa AA seqDB search
MNFWDLLLVVWSTCFFSLPSDALQRIVLKKMPSIQENMKLKGKDLGKFNMEWLSYTKQLT
LFNVMSPVRLTNFEDTQYYGEISIGNPSQTFQVVFDTGSADFWVPSSKCSPLYTACVFHH
QYDSTKSSTYKENGTEFKIQYASGQVMGFLSEDTVTVGGIKMTQSFGEVTVLPLLPFGLA
KFDGVLGLGFPALSMSKIVPFFDNIISQGMLKKEVFSVYYSRNSENSHVPGGEIILGGSD
PKYYRGTFHYINISHPGFWQIQMNGVSVESNVLACQDGCIASVDTGASFITGPTSSMRKV
MKMLGVKEDGDQYLVQCDLASMLPDISFSLDGKPFTLHSSDYVLEDLKSDDNFCLLAFRG
LDIPPPTGPLWILGATFIRKFYTEFDRHNNRIGFAVAVQPVPGQGAKRQREMLPGA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctgggatctcctgctggtggtctggagcacttgcttcttcagtctgcccagt
gatgctttacaacggattgtcctcaagaaaatgccttcaatacaggaaaatatgaagctc
aaaggcaaggatctggggaaattcaacatggagtggctctcatataccaagcagctgacc
ctgtttaatgtaatgtcccctgttaggctcaccaattttgaggatacccagtattatggt
gagatcagtatcggcaacccatcccagaccttccaggttgtttttgacacgggctctgct
gacttttgggtgccctccagcaaatgtagcccactctacacagcatgtgtgttccaccat
caatacgactccaccaaatcttccacctacaaagagaatgggaccgaattcaaaatccag
tatgcatcaggccaagtcatgggcttcctgagcgaggatacagtgactgttggtgggatc
aaaatgacccagtcatttggtgaggtgacagtgctgcccctgttgccctttggactggcc
aagtttgatggtgtcctgggtctgggtttccctgccctatcaatgagcaaaatcgttcct
ttctttgacaacataatctcccaagggatgctgaaaaaagaagtcttctctgtctactac
agcaggaattccgagaattctcatgtgcccggtggagagattatactaggaggtagcgac
cccaagtattaccgcgggactttccactacatcaacatcagccatccaggcttctggcag
atccaaatgaacggggtttctgtcgaatccaatgtgttggcctgccaggatggttgcata
gcatctgtggacactggagcttccttcatcacaggtccaaccagctccatgaggaaagtg
atgaagatgctgggagttaaggaagatggagaccagtatcttgtacaatgtgacctggca
tccatgctcccagatatctccttctccctggacggcaagcccttcacactccacagttct
gactatgttttagaggatttgaagagcgatgataatttttgcttgctagccttccgaggc
ctggatataccaccccccacaggacctctatggattctgggagcaaccttcatccgaaaa
ttctacactgaatttgaccggcacaataatcgcattggttttgctgtggcagtccaacct
gttcctggtcagggggccaaaagacagagggagatgctgcctggggcctag

DBGET integrated database retrieval system