KEGG   Sarcophilus harrisii (Tasmanian devil): 100935150Help
Entry
100935150         CDS       T02286                                 

Gene name
REN
Definition
renin
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Renin-angiotensin system
Class
Organismal Systems; Endocrine system; Renin-angiotensin system [PATH:shr04614]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 413 aa AA seqDB search
MNFWDLLLVVWSTCFFSLPSDALQRIVLKKMPSIQENMKLKGKDLGKFNMEWLSYTKQLT
LFNVMSPVRLTNFEDTQYYGEISIGNPSQTFQVVFDTGSADFWVPSSKCSPLYTACVFHH
QYDSTKSSTYKENGTEFKIQYASGQVMGFLSEDTVTVGGIKMTQSFGEVTVLPLLPFGLA
KFDGVLGLGFPALSMSKIVPFFDNIISQGMLKKEVFSVYYSRNSHVPGGEIILGGSDPKY
YRGTFHYINISHPGFWQIQMNGVSVESNVLACQDGCIASVDTGASFITGPTSSMRKVMKM
LGVKEDGDQYLVQCDLASMLPDISFSLDGKPFTLHSSDYVLEDLKSDDNFCLLAFRGLDI
PPPTGPLWILGATFIRKFYTEFDRHNNRIGFAVAVQPVPGQGAKRQREMLPGA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaatttctgggatctcctgctggtggtctggagcacttgcttcttcagtctgcccagt
gatgctttacaacggattgtcctcaagaaaatgccttcaatacaggaaaatatgaagctc
aaaggcaaggatctggggaaattcaacatggagtggctctcatataccaagcagctgacc
ctgtttaatgtaatgtcccctgttaggctcaccaattttgaggatacccagtattatggt
gagatcagtatcggcaacccatcccagaccttccaggttgtttttgacacgggctctgct
gacttttgggtgccctccagcaaatgtagcccactctacacagcatgtgtgttccaccat
caatacgactccaccaaatcttccacctacaaagagaatgggaccgaattcaaaatccag
tatgcatcaggccaagtcatgggcttcctgagcgaggatacagtgactgttggtgggatc
aaaatgacccagtcatttggtgaggtgacagtgctgcccctgttgccctttggactggcc
aagtttgatggtgtcctgggtctgggtttccctgccctatcaatgagcaaaatcgttcct
ttctttgacaacataatctcccaagggatgctgaaaaaagaagtcttctctgtctactac
agcaggaattctcatgtgcccggtggagagattatactaggaggtagcgaccccaagtat
taccgcgggactttccactacatcaacatcagccatccaggcttctggcagatccaaatg
aacggggtttctgtcgaatccaatgtgttggcctgccaggatggttgcatagcatctgtg
gacactggagcttccttcatcacaggtccaaccagctccatgaggaaagtgatgaagatg
ctgggagttaaggaagatggagaccagtatcttgtacaatgtgacctggcatccatgctc
ccagatatctccttctccctggacggcaagcccttcacactccacagttctgactatgtt
ttagaggatttgaagagcgatgataatttttgcttgctagccttccgaggcctggatata
ccaccccccacaggacctctatggattctgggagcaaccttcatccgaaaattctacact
gaatttgaccggcacaataatcgcattggttttgctgtggcagtccaacctgttcctggt
cagggggccaaaagacagagggagatgctgcctggggcctag

DBGET integrated database retrieval system