KEGG   Sarcophilus harrisii (Tasmanian devil): 100935157Help
Entry
100935157         CDS       T02286                                 

Definition
maltase-glucoamylase, intestinal-like
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100935157
   00500 Starch and sucrose metabolism
    100935157
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100935157
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100935157
    3.2.1.20  alpha-glucosidase
     100935157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1797 aa AA seqDB search
MAKKTFSRLEIILSVLLLGLFIISIALIVLLATNTSGVKETITTSSPETTGTTTASPTVT
STSTSSTTLTPECPTVNLSERINCIPDQTPTQATCHQRGCCWSPQGPVTVPWCYFSKKYG
YQIKGSSNTSAGFTAQLSRLSTASMFGNDIANVILEAEYQTSNRFHFKIRDPNDVRYEVP
HEHVQPFTGNAANNLNYHVNIEKESFSIKVIRKSNNRVLFDTGIGPLLFAQQYLQLSIKL
PSANVYGLGEHVHQEYRHDMAWKTWPIFSRDNTPNDGMTNLYGAQTFFLCLEDISGLSFG
VFLMNSNAMEVALQPAPAITYRITGGILDFYVFLGNTPEEVVREYLELIGRPLLPSYWSL
GFHLSRWVYGGLDGMKKVVERNRAAQLPCDVQYSDIDYMDEKKDFTYDKVLFGGLPEFAE
DLHNHGQKYVIIMDPAIASDSPNYGPYVRGSNMKIWVNASDGVTPLIGKVWPGQTVFPDY
TNPKCAQWWAEEFSLFYKELKFDGIWIDMNEPSNFDDGSSTGCSHSNLNYPPFTPRILDH
FLPAKTLCMDAVQYWGKHYDVHNLYGYSMAIATEEAVKAVFNNKRSFIVTRSTFAGSGKF
AAHWLGDNAATWNDLRWSIPGVLEFNLFGIPMVGPDICGYANDVSEELCRRWMQLGAFYP
FSRNHNGQGYKDQDPAAFGEDSLLLNTSRHYLNIRYTLLPYLYTLFFQAHTRGDTVARPL
LHEFYADNYTWDVYRQFLWGPGLLITPVLEEGAEKVTAYMPDAIWYDYETGNRTSWRKQE
VELLLPPDKIGLHLRGGYIFPTQQPAITTVASRKNPLGLIIALDDNNEAKGELFWDDGET
KGTITSGAYILHEFLYTQNRLDVKILHNSYNDIYNLTFNEIKILGTKEPINIIVKKNNVL
IASSPNVTYIEEYQVAIISGLELSLGEEYTVELSFSFRDVDKIDCYPEDQAVSEENCTAR
GCVWELPSSPGVPSCYIINFLYSVSNIQSNPMGITADIFLNSALYASNLPSTPVNPLRLD
VTYHKNDMLQFKIYDANSKRYEVPVPLNIPRSPSSTPDNRLYEVFIKSNPFGIEIRRRST
GTVIWDSKIPGFTFNDMFLRISTRLPSHYIYGFGETEHTTFRRNLTWHTWGMFSRDQPPG
YKKNSYGVHPYYMALEEDGNAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPT
PDLVTQQYTKLVGRPVMTPYWALGFQLCRYGYQNDTEIAELYDAMVAAQIPYDVQYADID
YMERQLDFTLSSKFSGFPNLINRIKAAGMRVILILDPAISGNETIYPAFSRGLQDNVFIK
WPDDSDIVWGKVWPDLPNITINASLDWDTQVELYRAHVAFPDFFRNSTTIWWKRELQELH
TNPQEPQKSLKFDGMWIDMNEPSSFVNGAVPPGCRNTTLNHPPYMPYLESRDRGLSSKTL
CMESQQILPDGSPVRHYDVHNLYGWSQTKPTYEGVQEATGQRGIVVTRSTFPSSGRWAGH
WLGDNTAAWDQLHKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCARWMQLGAFYPFSR
NHNTIGTRRQDPVAWNSTFEALSRKVLQTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFL
EDKETWDIYHQFLWGPAFLVSPVLTPNSRNLTAYFPKASWYDYYTGSGVGVRGQWTILHA
PLDHINLHIRGGYILPWQKPANNTHYSRKNSLGLIVALSDNGIAEGEFFWDDGQSIDTYE
KGDVYFSTFSASQVSVIGSFYYLFISSAQSADKNDMKKVLLYDNPSGSHDLDPRATF
NT seq 5394 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagacttttagcagattggagataatccttagtgttctgttactgggattg
ttcatcatctctattgccctgattgtgcttttagctacaaatacttcaggagtgaaagaa
actatcactacttcaagtcctgagacaacagggacgacaacagcctccccaacagtgact
tccacatccacctcttcgactactttaactccagaatgccctacagtaaacctgtcagaa
aggatcaactgcatccctgatcaaacaccaacacaggccacatgtcaccaacgtggttgt
tgctggagccctcagggaccagtaactgttccctggtgctacttctccaagaagtatggc
tatcagataaagggtagtagtaacacgagtgcaggattcacagcccagttaagccgactc
tccacagcttcgatgtttggaaatgatattgccaatgtcattcttgaagcagaataccag
acttccaatcgtttccatttcaagatccgagatcccaatgatgtcagatacgaagtccct
catgaacatgtccagccatttactggaaatgcagctaataatttgaactatcatgtgaac
attgaaaaggagtcatttagcatcaaagttatccggaaaagtaacaatcgtgttttattc
gacactggtattgggcctctcctatttgctcaacaatacctgcagctctccatcaagcta
cccagtgctaatgtgtatggcctaggggagcatgttcatcaagagtaccgtcatgatatg
gcttggaagacttggcccatcttctctcgggacaatactcctaatgatggcatgactaat
ttgtatggagcgcagacatttttcttgtgccttgaagatataagtggattatcctttgga
gtttttctgatgaacagcaatgccatggaggttgcccttcaacctgccccagcaatcact
tatcgaatcaccgggggtattctggacttttatgtcttcttagggaatactccagaagag
gttgttcgggaataccttgagcttattggaaggccactcttgccatcttattggtctctt
ggatttcatctcagtcgctgggtgtatggaggtttggatggaatgaagaaagttgtggag
agaaaccgagctgctcagcttccttgtgatgttcagtactctgatattgactatatggat
gagaagaaggatttcacttatgataaagtactatttggaggtctacctgaatttgctgag
gatttacataaccacggacagaaatatgtcattattatggatccagccattgccagtgac
tctcccaactatggtccttatgtccggggctcaaacatgaagatatgggtcaatgcatcg
gatggagtgacaccacttattgggaaggtgtggccgggccagacggtctttccagactat
accaatccaaagtgtgcccagtggtgggcagaggagttcagccttttctacaaggagcta
aagtttgatggaatctggattgatatgaatgaaccctccaactttgatgatggttcatct
acgggatgctcacatagtaacctgaactatcccccatttactcctagaatactggatcac
tttctacctgccaaaaccctttgcatggatgcagttcagtactggggaaaacactatgat
gttcacaatctgtatggttactccatggcaattgcaacagaagaggctgtaaaagctgtc
ttcaataataaaagaagctttattgtcacacgctctacctttgctgggtcaggcaaattt
gcagctcattggctgggggacaatgcagccacttggaatgaccttcgctggtctatacct
ggtgtgcttgagttcaacttgtttggtatccctatggtgggccctgacatctgtggttat
gccaatgatgtctcagaagaactatgcaggcggtggatgcagcttggtgcattttatcca
ttttccaggaatcacaatggtcaaggctacaaggatcaggaccctgctgcatttggagaa
gattctcttcttttaaatacctccagacactacctgaatatccgctatactctgctgcct
tatctctataccctctttttccaagctcacactcgaggggacactgtagcccgacccctt
ctacatgagttttatgctgacaattatacctgggatgtgtatcggcagtttttgtggggg
cctgggcttcttattactcctgttctggaggaaggggctgagaaagtgacagcatatatg
cctgatgctatctggtatgactatgaaactggtaatcggacatcatggagaaaacaagag
gttgagctgttactccccccagacaaaattggactccatcttcgaggaggctatattttc
cccacacagcagccagccatcaccacagtagcaagccgaaagaatcctcttggtctcatc
attgcccttgatgacaataatgaagctaaaggagaacttttttgggacgatggagaaact
aaaggtactataactagtggtgcctacatcttgcatgagtttttgtacacccaaaaccgt
ttagatgtgaagattttgcataattcatacaatgatatttataacttaacatttaacgag
attaaaatccttgggacaaaagaacctattaatatcattgtgaagaagaataatgtcctc
attgcatcttctcctaatgttacttatattgaagaataccaggttgctattatctcaggg
cttgaactttccttgggagaagaatacactgtggaattgagtttcagtttcagagatgtg
gacaaaatagactgttatcccgaggaccaagcagtctctgaagaaaactgcacagctcgt
ggctgtgtctgggagttacccagttctccaggagttcctagctgctatatcatcaatttc
ctatattcagtcagtaacattcaatccaacccaatggggattactgctgatatcttctta
aattcagctttgtatgcttccaatttgccttctactcctgtgaatcctctccgcttagat
gtcacctaccataagaatgatatgctgcagtttaagatctatgatgctaatagcaaaaga
tatgaggtcccagtgccactcaacatccctagatctccctctagtacccctgacaatcgg
ctctatgaagttttcataaagagcaatccttttggaattgagatccgacgccggagcact
ggcacagtaatttgggattctaagatccctggttttacctttaatgacatgttcctgcgc
atctctactcgcctcccatcccattacatctatggttttggggaaacggagcacacgacc
ttccgaagaaatctgacctggcacacatggggcatgttttctcgagaccagccccctggg
tacaagaagaattcctatggtgtgcacccttattatatggctctggaggaggatggcaat
gcacatggggtgctcctgctcaacagcaatgccatggatgtgactttccagcccaccccg
gcactgacataccgcaccactgggggcattctggacttctacatggttttgggaccaacc
ccagatcttgtcactcagcagtacaccaagttggttgggcgaccagtgatgacaccttat
tgggccttagggttccagctttgtcgctatggctaccagaatgatactgaaattgctgaa
ctttatgatgctatggtggcagcccagatcccttatgatgtgcagtatgcagatattgat
tacatggaacggcaactggacttcactctcagctccaagttttctggctttcccaatctg
atcaatagaataaaagcagccgggatgcgagtcatccttattctggacccagccatttct
ggtaatgagacaatttatcctgcattctctcgtggacttcaggataatgtgttcatcaaa
tggccagatgacagtgacattgtttggggaaaggtctggccagatttgcccaatattact
atcaacgcatctcttgattgggacacccaagtggagctatacagagctcatgttgccttc
ccagactttttccgtaattcaacaaccatatggtggaagcgtgaattacaagaactccac
accaatcctcaggagccacagaagagtctgaagtttgatggaatgtggattgacatgaat
gaaccatccagctttgtgaatggagcagttcctccaggctgcaggaataccacgctcaat
catcctccttatatgccctatctagagtcaagagacagaggcctgagcagcaagactctg
tgcatggaaagtcagcagatcctgcctgatggaagcccagtgagacactatgatgtgcac
aatctctatggctggtcccagactaagccaacatatgaaggtgtgcaggaggctactgga
cagagaggaattgtggtcactcgctccaccttcccttcttcaggacgctgggcaggacat
tggctgggggacaacactgcagcatgggaccagctccataaatccatcattggtatgatg
gaattcagcctctttggaatatcctatactggagccgatatctgtggcttctttggagat
gctgaatatgagatgtgtgctcgctggatgcaactgggagccttttaccctttctctagg
aaccacaataccattgggaccagaagacaagaccctgtggcttggaattccacctttgag
gctctttcaagaaaagtccttcagacaagatacaccctattgccttatctctataccctg
atgcacaaggcccatgtagaaggcagcactgtcgtccggccccttcttcatgaatttctg
gaagacaaagaaacgtgggacatataccatcaattcttgtgggggccagccttcctagtc
agtcctgtactgacacctaattcccggaatctcactgcctacttccctaaagccagctgg
tatgattattacacgggctcaggtgttggagtgaggggacagtggacgatcctgcatgct
cccttggaccacatcaatctccatatccgtggaggctacattcttccatggcaaaaacct
gccaataatactcactatagccggaaaaattccttgggacttattgtggctttatctgac
aacgggatagctgaaggagagtttttctgggatgatggacagagtattgatacttatgaa
aagggggatgtctatttctcaactttctctgccagtcaggtgagtgttattggttccttt
tattacttgttcatttcttcagcacaatcagctgataaaaatgatatgaagaaagtccta
ctttatgataacccttctgggagccatgacttagatccaagagccaccttttga

DBGET integrated database retrieval system