KEGG   Sarcophilus harrisii (Tasmanian devil): 100935179Help
Entry
100935179         CDS       T02286                                 

Gene name
LAMC3
Definition
(RefSeq) laminin, gamma 3
  KO
K06247  
laminin, gamma 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100935179 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100935179 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100935179 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100935179 (LAMC3)
   05222 Small cell lung cancer
    100935179 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    100935179 (LAMC3)
   05145 Toxoplasmosis
    100935179 (LAMC3)
Cell adhesion molecules and their ligands [BR:shr04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-14 Extracellular matrix (ECM) components
     100935179 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1580 aa AA seqDB search
MEEFLGLSLGILLCLALAQGGMDACYDERGRPQRCLPVFENAAFGRQAQVTNTCGSPPEE
YCLQMGAPGDTQLCHRCDARHPDHSHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSVNI
TLQLGKAYEITYVRLKFHTSRPESFAIYKRSWAGGPWVPYQYYSASCEKTYGKREDQYLR
PGEDERVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYSFDESPILQEWVTSTDLLISLNR
LNTFGDDIFKDPKVLQSYYYAITDFSVGGRCKCNGHASECVLDEGGQLVCSCQHNTTGTD
CERCLPFYQDRPWARGTAEAANECLPCNCSGLSEECFYDWELYRSTGRGGHCRNCRDHTA
GPHCEYCQENFYRWDQQQPCQPCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDRCLTGFH
SLSEGGCRACACNGAGSLGPCDSRNGRCPCKDKVEGYLCDRCQPGTFNLQPHNPSGCTSC
FCYGHSMVCAASTHYGIRYIISEFHQGAEGWQIRGPGGREKPAQWSQRGIFLEPKGEELW
DFVAPEKFLGDQRFSYGQSLSLTFWVPPGGSLLPVRLKLEGAGLTLFLKPSSPTASQQPG
RPEEYLLVFSLQETSEDTNLPLPAFHFQRLLANLTGLQIEITGPGGRHSTGQMILTEVQL
TSAGPGLSPLAPWVEECTCPEGYMGQFCESCSLGYKRETPLGGPYASCVPCTCNQHGTCD
PETGICQCLHHTEGPYCERCTSGFYGNPFLGHVDDCKPCPCPGQSACTTIPESGEVVCTH
CPKGQRGRLCEICDDGFFGDPLGRSGPRQPCQRCQCNGNVDPNAVGNCNPTTGHCLRCLY
NTTGAHCEQCQEGFYGSALAPHPLDKCTPCSCNSSGSTREQGACDPRTGQCSCLPHVTGR
DCSHCSPGFYDLQPERGCRSCKCHPVGSQENQCHPVTGQCPCLPGVSGVACTHCQPDFFG
FSAKGCRACNCSPLGSVTTQCHENSTCVCKPGFVGYKCDHCKENFFLTAEGSQCQECPIC
FSLVKKEATKLKATLTMMEQWLRKSDCDSPWSNYILLGESTRGDAYQGSYLLQGTREAFL
EQMEELESSMRAARHQLRAASESVNCAKNSLEKTCIQLEDIEALLLSTEQEVQQASGALR
TMVIPQEVPHQLTNWSHLASESQALAKSHRDIATKIEAAAQRALLASNTSYTLLWSLVEG
TDAQKIQRELEDKYQEVQRAQEELRTSTAQAVKEAKSVLTSVQHVSSERARHLAKLSTPE
ILPLTHLARDLDRKLQDLEKTVASREQVFTRAAQDLLATSQGEFQKIQPFQQPQLHDGAD
AALSLATSSIAKTRVTVRDSKTLLTDLEEMRKTFPQPKDQASLRRKARIIQDKLIGDTQK
KTKQAERMLGNAASVSATAKKKAKEAELLAKESTKHSKALLRESKQQYRQAVKLANQAQG
ALRDISRQVMVSKDRRKEMEKIEWVGTGLNKVERSIREARISLEMDIKTLSILLTRLGKL
DPYQALASALNETEQKLEPLRQRLDGQGPLQDKLSLLEQEAEQQELQIQDLESDLKEIQA
DKQNLEDILHSLPEGCASWQ
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atggaggagttcctcgggctctctctggggatcttgctctgcctggctctggcccagggg
ggcatggatgcttgctatgatgagcgagggcgccctcagcgttgtctgcctgtgtttgag
aatgcagcctttggccgccaggcccaggtgaccaacacctgtggctcgccacccgaggag
tactgcctccagatgggcgcccctggagacacccagctgtgccatcgctgtgacgcccgc
cacccggaccacagccacaatgcctcctacctgacggacttccacagccaggaggagagc
acctggtggcagagccagtccatggccttcggggtccagtaccccaactcggtcaatatc
accctgcagctgggaaaagcttatgagatcacctacgtgaggctgaagttccacaccagc
cgtcctgagagttttgccatctacaaacgcagctgggctgggggtccctgggtgccatat
cagtattatagtgcttcctgtgagaagacgtacggcaagcgggaggaccagtacctccgg
cccggggaggatgagagggtggccttctgcactgatgagttcagcgacatctctccactg
agtggaggcaacgtagccttttccaccctggaaggccggcccagtgcctacagctttgat
gagagtcccatcctgcaggaatgggtaaccagcacagacctactcatctccctgaaccgg
ctcaacacatttggggatgacatctttaaggaccctaaagtgttacagtcctactattac
gccatcactgacttttctgtggggggcaggtgcaagtgtaacgggcatgctagcgaatgt
gtacttgatgaaggaggccagctagtctgcagctgccagcacaacactacaggaacggac
tgtgagagatgcctccccttctaccaagaccgaccctgggcacggggcacagcggaggct
gccaatgagtgtctgccctgcaattgcagtggcctctctgaagaatgtttttatgattgg
gagctgtatcggagcactggtcgtggggggcactgccggaactgtcgggaccacactgct
ggaccccattgtgaatattgccaagagaacttctatcgctgggatcagcagcagccatgt
cagccctgtgattgccacccagctggatctcttagcttacagtgtgacaactcaggcacc
tgtgagtgtaaacccagtgtaactggttggaagtgtgatcgctgcctgacagggttccat
tctcttagtgaaggtggatgcagagcctgtgcctgcaatggtgccggcagcttaggacct
tgtgattccagaaacggaagatgcccttgcaaggacaaggtggaaggctacttatgtgat
agatgccaacctgggacatttaacctgcagccccataatccttctggttgcaccagctgc
ttctgttatggccactccatggtgtgtgcagcttccacccattatggtatacgctatatc
atctctgagttccaccagggagctgaaggctggcaaatcagaggtccagggggcagagag
aagcctgcacagtggagccagcgtggaattttcctggagccaaagggagaggagctatgg
gactttgttgcaccagagaaattcctgggagaccagcgcttcagctatgggcagtccctc
tctctgaccttctgggtcccacctgggggctctctcctccctgtccggctgaagttggaa
ggggcaggactaaccctgtttctgaaaccctccagcccaacagcctcccaacaacctggc
cggcctgaggaatacctgctggtattcagcttgcaggagacctcagaagacacaaatctc
ccgctccctgcctttcacttccagaggctcttggccaacctgacaggactccagattgaa
atcacaggtcctggaggcaggcattccacaggtcaaatgatcctgactgaggtccagctc
acgtcagcaggccctggtctgtccccgctagccccctgggtagaggagtgtacatgtccc
gagggatacatggggcagttctgtgaatcctgctctctggggtacaagagggagacacca
ttgggcgggccttatgccagctgtgtcccctgcacctgtaatcaacatggcacctgtgat
cctgaaacagggatttgtcagtgcctgcaccatacagaaggcccttactgtgagcgatgc
acatctggtttctatggcaacccctttttgggtcatgtggatgactgcaagccctgtcct
tgtcctggtcaatcagcttgtacaaccatcccagagagtggagaggtggtgtgtacccat
tgccctaagggtcagagaggacgtctgtgtgagatatgtgatgatggctttttcggggac
cccttgggaagatctggccctcgccaaccctgccagcgatgccagtgcaatgggaatgtg
gaccccaatgctgtgggcaactgtaaccccacaacaggccactgcctgcgctgcttatac
aacacaacaggtgcccactgtgagcagtgccaagagggtttctatgggagtgctctggcc
ccacaccctctagacaaatgcaccccctgcagctgtaactcatcaggctcaaccagagag
cagggggcttgcgaccccaggacaggccagtgttcatgcctcccccacgtgaccggacga
gactgcagtcactgtagccctggtttctatgatctccagccagagaggggctgcaggagc
tgcaagtgccatcctgtaggctctcaggagaaccagtgccaccctgtgactgggcagtgc
ccttgccttcccggggtcagtggagtggcatgtacccactgccaacctgatttctttggc
ttctctgccaagggctgccgagcctgtaactgctccccactgggctctgtcaccacccag
tgccacgagaacagcacttgtgtgtgtaagccaggcttcgtgggctacaagtgtgatcac
tgcaaggagaactttttcctcactgctgagggatctcagtgccaggagtgcccaatctgc
ttctccttagtgaagaaagaggccaccaaactcaaggccacgttaacaatgatggaacag
tggctgcgaaaatctgactgtgacagtccctggagcaattatatcttgctgggagagtca
acgagaggagatgcctaccagggaagttatttgcttcaaggcaccagagaagccttcctg
gagcaaatggaagaactggaaagttccatgagggctgcccggcatcagctgcgggcagca
agcgagagcgtcaactgtgccaaaaatagtttggagaagacctgcatccaactggaggat
atcgaggctctgctgctatcaacagagcaggaggttcagcaggcatctggagccctcagg
acgatggtaatccctcaagaagtaccccaccagctcaccaattggagtcatctagcctct
gagtctcaggctctggccaagagtcatagagacatagccactaagatagaggcagctgca
caaagggctctgctggcttccaataccagttatactcttctatggagtcttgtggaggga
acggatgcccagaagatccagcgtgagctagaggacaaataccaggaggtgcagagggcc
caggaggagctcagaacatccacagcccaggcagtcaaagaagccaagagcgtattaaca
tctgttcagcatgtcagctccgagagggctcggcacctagcaaagctctccactcctgaa
atactgcctctcacacaccttgccagggacctggacagaaaattacaggatctagagaag
acagtggcttctagggagcaagtgttcaccagagcagcccaggatctcttggctacttcc
cagggagagttccagaagatccagccctttcagcagccacagctccatgatggggctgat
gctgccctcagcctggccacctcatccattgccaaaaccagagtcacagtcagggattcc
aagactttgctgaccgatctggaagaaatgagaaaaacatttccacagcccaaggaccag
gcttctctaaggagaaaggcgaggatcatccaagacaaactcattggtgacacccagaag
aagactaagcaggcagaaagaatgctaggaaatgctgcttctgtctccgccacagctaag
aagaaggccaaggaagctgaactactggctaaagagagtacaaagcattccaaagccttg
ctgagggaaagtaaacagcaataccgacaagcagtcaaacttgccaaccaagcacaagga
gccctgcgagacatctccaggcaggtgatggtgtccaaggaccgaaggaaggagatggag
aaaattgaatgggtagggactgggttgaacaaggtggaaagaagcataagggaagctcgg
atctccctggagatggacatcaagaccttgtctattctgcttaccagactgggaaagctg
gacccttaccaagctctagcttcagccctgaatgagactgagcagaagctggagccactg
aggcagcgcctggacgggcaggggcccctgcaggataaactgagcctgctggagcaggag
gcagagcagcaggagctccagatccaagacttggagagtgacctcaaggaaatccaggca
gacaagcagaacctggaggacattctgcacagcctgcctgagggctgtgccagctggcag
tga

DBGET integrated database retrieval system