KEGG   Sarcophilus harrisii (Tasmanian devil): 100935396Help
Entry
100935396         CDS       T02286                                 

Gene name
CLTC
Definition
(RefSeq) clathrin heavy chain 1
  KO
K04646  clathrin heavy chain
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04142  Lysosome
shr04144  Endocytosis
shr04721  Synaptic vesicle cycle
shr04961  Endocrine and other factor-regulated calcium reabsorption
shr05016  Huntington's disease
shr05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100935396 (CLTC)
   04142 Lysosome
    100935396 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100935396 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    100935396 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100935396 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100935396 (CLTC)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    100935396 (CLTC)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100935396 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_1
Motif
Other DBs
NCBI-GeneID: 100935396
NCBI-ProteinID: XP_023357898
Ensembl: ENSSHAG00000016622
Position
4
AA seq 1620 aa AA seqDB search
MESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIF
NIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGC
QIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAE
ESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHD
VVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEE
ENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGI
LRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKW
LKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYT
PDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALK
NNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFT
DLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHE
QLSTQSLIELFESFKSFEVKVCTFVANTTTSKKIAQQKSSDFLICVLFQEAKLTDQLPLI
IVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILV
VRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLR
ENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPEL
WGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDN
SVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKF
DVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPS
SYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNN
AHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKE
VCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMG
MFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAI
ITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRA
VNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISL
AQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDRLYKDAMQYASESKDTELAEELLQ
WFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLSKVDKLDA
SESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagacaaattcatctgcattagagaaaaagtaggagagcaggcccaggtggta
atcattgatatgaatgatccaagtaatcccattcgtcgaccaatttcagctgacagtgcc
atcatgaatccagctagcaaagtaattgcattaaaagctgggaaaacacttcaaatattt
aacattgaaatgaaaagtaaaatgaaggctcacaccatgactgatgatgtcaccttttgg
aaatggatttctttgaatactgttgcccttgttacggacaatgcagtctatcactggagt
atggaaggagagtcacaaccagtgaagatgtttgatcggcattctagtcttgctggttgc
cagattatcaactatcgtacagatgcaaagcagaagtggttacttcttactggcatatct
gcacagcaaaatcgcgtggtgggcgccatgcaactctattctgtagacagaaaagtgtct
cagcccattgaaggacatgctgctagctttgcacaatttaagatggaaggaaatgctgaa
gagtcaacactgttttgttttgcagtaaggggacaagctggaggcaagttacatatcatt
gaagtcggcaccccacctacagggaatcagccttttccaaagaaagcagtagatgtcttt
tttcctccagaagctcaaaatgactttcctgtggcaatgcagatcagtgaaaaacatgat
gtggtattcttgattaccaagtatggctatatccacttatatgacctggagactggtacc
tgcatttacatgaatagaatcagtggagaaaccatctttgttactgcacctcatgaagca
acagctggaattattggtgtaaacagaaagggacaagtcctatcagtgtgtgtggaagaa
gagaatataattccttatatcaccaacgtcctacagaatcctgatctcgctttgcgaatg
gctgtacgtaacaacttagctggagctgaagagctttttgctcggaaatttaatgctctc
tttgcacaagggaattactcagaggcagcaaaggtggctgctaatgcaccaaagggaata
ttacgtactccagacaccattcgtcggttccagagtgttccagcacaaccaggtcagact
tcacctctactccagtactttggaatccttttagatcaaggccaactgaacaaatatgaa
tccttagaactctgtaggcctgtgcttcaacaggggcgcaaacagctgctagagaaatgg
ttaaaagaagataagctggagtgttcagaagaattgggtgatctagtaaagtctgtggac
cctacattggcacttagtgtgtacctacgggctaatgttccaaataaagttatccagtgc
tttgcagaaacaggccaagtacagaagattgtactatatgccaaaaaagttggttatact
ccagattggatctttctattgagaaatgtaatgaggatcagcccagatcaaggtcaacag
tttgctcaaatgttggttcaagatgaagaaccacttgcggatataacacagattgttgac
gtgtttatggaatacaatttaatccagcagtgtactgcatttttactcgatgccctgaaa
aataatcgcccatctgagggccccctgcaaacaaggctgcttgagatgaaccttatgcat
gcccctcaagttgcagatgctattttaggaaaccagatgttcacacattatgaccgggct
catatcgctcaactctgtgaaaaggctggcctgttacagcgtgcactggagcattttact
gatctttatgatattaagcgtgcagttgttcacactcatcttctgaaccctgagtggtta
gtcaattactttggttccttatctgtggaagattccttggagtgcctcagggctatgctt
tctgccaatattcgccaaaacctacaaatttgtgtccaggtggcttccaagtatcatgaa
cagctttcaactcagtccttgattgaactgtttgaatcttttaaaagttttgaagtgaaa
gtgtgcacatttgtggctaacactacaacttctaagaagatagcacaacagaaatcatct
gattttcttatatgtgttctttttcaggaagcaaaactaacagaccagttaccactcatc
attgtttgtgatcgatttgattttgttcatgacttggtgctctatttatatagaaataat
ctccaaaaatatatcgagatttatgtacagaaggtgaatccaagccgtcttcctgtggtt
attggaggattgcttgatgttgattgctctgaagatgtcataaagaacttgattcttgta
gtgagaggtcagttctctaccgatgagcttgttgctgaagttgaaaagaggaacagatta
aaacttctactaccttggctagaagccaggattcatgaaggttgtgaggagcctgctact
cataatgcattagctaaaatctacattgacagtaacaacaatccagaaagatttcttcgt
gaaaatccctattatgatagtcgtgttgttggaaagtattgtgagaagagggatccccac
ttagcatgtgtggcttatgaacgtggccagtgtgatctggaacttattaatgtttgcaat
gaaaactctctcttcaaaagtctttcccgctatttggttcgccgtaaggatccagaactt
tggggtagtgttctcttagagagcaacccttataggaggcccctgattgaccaggtagta
cagacagcattgtctgagactcaggaccctgaagaggtatctgttactgtcaaggccttc
atgactgcagaccttcccaatgaactcattgaactattggagaaaattgttcttgacaac
tcagtgttcagtgaacataggaatctacaaaacctccttatcctcactgcaattaaagct
gatcgtacccgggttatggaatatatcaaccgactagataattatgatgctccagacatt
gctaatattgcaatcagcaatgagttgtttgaagaagcatttgccattttcaggaaattt
gatgttaatacttcagctgtgcaggttttgattgaacatattggaaacctggatcgtgca
tatgagtttgctgaacgctgcaatgagcctgcagtgtggagtcaacttgcaaaagctcag
ttgcagaaagggatggtgaaagaagccattgattcttatatcaaagctgatgatccttca
tcttacatggaagttgttcaggctgccaatactagtggcaactgggaagaactggttaag
tacctgcagatggctcgcaagaaggctcgtgagtcttacgtagaaacggaattgatcttt
gctctggctaagaccaatcgccttgcagagctggaggaattcatcaatgggccaaataat
gctcatattcaacaagttggggatcgttgttatgatgagaaaatgtatgatgctgctaaa
ttattatacaacaatgtttccaattttggtcgcttggcatctaccctagttcacttgggt
gaatatcaggcagctgttgatggggcacggaaagctaacagcacaagaacatggaaggag
gtctgctttgcctgtgtagatgggaaagagttccgcttagcccagatgtgtggccttcat
attgtggtgcatgcagatgaactggaggagctcataaactactatcaggatcgaggatac
tttgaagaattgataaccatgttggaagcagcactggggcttgagcgagctcatatgggg
atgtttactgaattagctattctctactcaaaattcaagccacagaaaatgagggagcat
ttggagttgttctggtccagagtgaatattccaaaggtgctaagggctgcagaacaagca
catctttgggcagagctggtatttttatatgataaatatgaagagtatgacaatgccata
attacgatgatgaatcatccaacggatgcatggaaagaaggacaatttaaagatatcata
accaaggtagccaatgtggaattatattatagagcaatacaattctatttagaattcaag
cctctgctactaaatgatctgctgatggtattatctccaaggttggatcatactcgtgct
gtcaactatttcagtaaggttaaacagcttccattggttaaaccatacctacgctcagtt
caaaaccataacaacaaatcagtgaatgaatcattgaataacctcttcattacagaagaa
gattatcaggcgctgagaacgtcaatagatgcgtatgacaattttgataatatctccctt
gctcaacgtttggagaaacatgagctcattgagttcagaagaattgctgcatatctcttc
aaaggcaacaatcgctggaaacaaagtgtagagttatgcaagaaagaccgactttataag
gatgcaatgcagtatgcctctgaatcaaaagatacagaattggcagaagagctgctacag
tggtttttgcaagaagaaaagagagagtgctttggagcttgtctctttacctgttatgat
ctgttaaggccagatgttgtcttggaaactgcgtggaggcacaatatcatggactttgcc
atgccctattttatccaggtcatgaaggaatacttgtccaaggtggataaactagatgcc
tccgaatctctgagaaaagaagaggaacaggctacagaaacgcaacctatcgtttatggt
cagccacagttgatgttgacagcagggcccagcgtggcagttcctccacaagcacctttt
ggctatggctacactgcacccccctatgggcagccacaacctggctttggatacagcatg
tga

DBGET integrated database retrieval system