KEGG   Sarcophilus harrisii (Tasmanian devil): 100935396Help
Entry
100935396         CDS       T02286                                 

Gene name
CLTC
Definition
(RefSeq) clathrin, heavy chain (Hc)
  KO
K04646  
clathrin heavy chain
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:shr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100935396 (CLTC)
   04142 Lysosome
    100935396 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100935396 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    100935396 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100935396 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100935396 (CLTC)
Exosome [BR:shr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100935396 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1600 aa AA seqDB search
MESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIF
NIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGC
QIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAE
ESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHD
VVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEE
ENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGI
LRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKW
LKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYT
PDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALK
NNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFT
DLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHE
QLSTQSLIELFESFKSFEDPVVVFLGTTREAKLTDQLPLIIVCDRFDFVHDLVLYLYRNN
LQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRL
KLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPH
LACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVV
QTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKA
DRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRA
YEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSGNWEELVK
YLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAK
LLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLH
IVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREH
LELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDII
TKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSV
QNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLF
KGNNRWKQSVELCKKDRLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYD
LLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLSKVDKLDASESLRKEEEQATETQPIVYG
QPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 4803 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagacaaattcatctgcattagagaaaaagtaggagagcaggcccaggtggta
atcattgatatgaatgatccaagtaatcccattcgtcgaccaatttcagctgacagtgcc
atcatgaatccagctagcaaagtaattgcattaaaagctgggaaaacacttcaaatattt
aacattgaaatgaaaagtaaaatgaaggctcacaccatgactgatgatgtcaccttttgg
aaatggatttctttgaatactgttgcccttgttacggacaatgcagtctatcactggagt
atggaaggagagtcacaaccagtgaagatgtttgatcggcattctagtcttgctggttgc
cagattatcaactatcgtacagatgcaaagcagaagtggttacttcttactggcatatct
gcacagcaaaatcgcgtggtgggcgccatgcaactctattctgtagacagaaaagtgtct
cagcccattgaaggacatgctgctagctttgcacaatttaagatggaaggaaatgctgaa
gagtcaacactgttttgttttgcagtaaggggacaagctggaggcaagttacatatcatt
gaagtcggcaccccacctacagggaatcagccttttccaaagaaagcagtagatgtcttt
tttcctccagaagctcaaaatgactttcctgtggcaatgcagatcagtgaaaaacatgat
gtggtattcttgattaccaagtatggctatatccacttatatgacctggagactggtacc
tgcatttacatgaatagaatcagtggagaaaccatctttgttactgcacctcatgaagca
acagctggaattattggtgtaaacagaaagggacaagtcctatcagtgtgtgtggaagaa
gagaatataattccttatatcaccaacgtcctacagaatcctgatctcgctttgcgaatg
gctgtacgtaacaacttagctggagctgaagagctttttgctcggaaatttaatgctctc
tttgcacaagggaattactcagaggcagcaaaggtggctgctaatgcaccaaagggaata
ttacgtactccagacaccattcgtcggttccagagtgttccagcacaaccaggtcagact
tcacctctactccagtactttggaatccttttagatcaaggccaactgaacaaatatgaa
tccttagaactctgtaggcctgtgcttcaacaggggcgcaaacagctgctagagaaatgg
ttaaaagaagataagctggagtgttcagaagaattgggtgatctagtaaagtctgtggac
cctacattggcacttagtgtgtacctacgggctaatgttccaaataaagttatccagtgc
tttgcagaaacaggccaagtacagaagattgtactatatgccaaaaaagttggttatact
ccagattggatctttctattgagaaatgtaatgaggatcagcccagatcaaggtcaacag
tttgctcaaatgttggttcaagatgaagaaccacttgcggatataacacagattgttgac
gtgtttatggaatacaatttaatccagcagtgtactgcatttttactcgatgccctgaaa
aataatcgcccatctgagggccccctgcaaacaaggctgcttgagatgaaccttatgcat
gcccctcaagttgcagatgctattttaggaaaccagatgttcacacattatgaccgggct
catatcgctcaactctgtgaaaaggctggcctgttacagcgtgcactggagcattttact
gatctttatgatattaagcgtgcagttgttcacactcatcttctgaaccctgagtggtta
gtcaattactttggttccttatctgtggaagattccttggagtgcctcagggctatgctt
tctgccaatattcgccaaaacctacaaatttgtgtccaggtggcttccaagtatcatgaa
cagctttcaactcagtccttgattgaactgtttgaatcttttaaaagttttgaagaccca
gtagtggtgtttctaggaactactagggaagcaaaactaacagaccagttaccactcatc
attgtttgtgatcgatttgattttgttcatgacttggtgctctatttatatagaaataat
ctccaaaaatatatcgagatttatgtacagaaggtgaatccaagccgtcttcctgtggtt
attggaggattgcttgatgttgattgctctgaagatgtcataaagaacttgattcttgta
gtgagaggtcagttctctaccgatgagcttgttgctgaagttgaaaagaggaacagatta
aaacttctactaccttggctagaagccaggattcatgaaggttgtgaggagcctgctact
cataatgcattagctaaaatctacattgacagtaacaacaatccagaaagatttcttcgt
gaaaatccctattatgatagtcgtgttgttggaaagtattgtgagaagagggatccccac
ttagcatgtgtggcttatgaacgtggccagtgtgatctggaacttattaatgtttgcaat
gaaaactctctcttcaaaagtctttcccgctatttggttcgccgtaaggatccagaactt
tggggtagtgttctcttagagagcaacccttataggaggcccctgattgaccaggtagta
cagacagcattgtctgagactcaggaccctgaagaggtatctgttactgtcaaggccttc
atgactgcagaccttcccaatgaactcattgaactattggagaaaattgttcttgacaac
tcagtgttcagtgaacataggaatctacaaaacctccttatcctcactgcaattaaagct
gatcgtacccgggttatggaatatatcaaccgactagataattatgatgctccagacatt
gctaatattgcaatcagcaatgagttgtttgaagaagcatttgccattttcaggaaattt
gatgttaatacttcagctgtgcaggttttgattgaacatattggaaacctggatcgtgca
tatgagtttgctgaacgctgcaatgagcctgcagtgtggagtcaacttgcaaaagctcag
ttgcagaaagggatggtgaaagaagccattgattcttatatcaaagctgatgatccttca
tcttacatggaagttgttcaggctgccaatactagtggcaactgggaagaactggttaag
tacctgcagatggctcgcaagaaggctcgtgagtcttacgtagaaacggaattgatcttt
gctctggctaagaccaatcgccttgcagagctggaggaattcatcaatgggccaaataat
gctcatattcaacaagttggggatcgttgttatgatgagaaaatgtatgatgctgctaaa
ttattatacaacaatgtttccaattttggtcgcttggcatctaccctagttcacttgggt
gaatatcaggcagctgttgatggggcacggaaagctaacagcacaagaacatggaaggag
gtctgctttgcctgtgtagatgggaaagagttccgcttagcccagatgtgtggccttcat
attgtggtgcatgcagatgaactggaggagctcataaactactatcaggatcgaggatac
tttgaagaattgataaccatgttggaagcagcactggggcttgagcgagctcatatgggg
atgtttactgaattagctattctctactcaaaattcaagccacagaaaatgagggagcat
ttggagttgttctggtccagagtgaatattccaaaggtgctaagggctgcagaacaagca
catctttgggcagagctggtatttttatatgataaatatgaagagtatgacaatgccata
attacgatgatgaatcatccaacggatgcatggaaagaaggacaatttaaagatatcata
accaaggtagccaatgtggaattatattatagagcaatacaattctatttagaattcaag
cctctgctactaaatgatctgctgatggtattatctccaaggttggatcatactcgtgct
gtcaactatttcagtaaggttaaacagcttccattggttaaaccatacctacgctcagtt
caaaaccataacaacaaatcagtgaatgaatcattgaataacctcttcattacagaagaa
gattatcaggcgctgagaacgtcaatagatgcgtatgacaattttgataatatctccctt
gctcaacgtttggagaaacatgagctcattgagttcagaagaattgctgcatatctcttc
aaaggcaacaatcgctggaaacaaagtgtagagttatgcaagaaagaccgactttataag
gatgcaatgcagtatgcctctgaatcaaaagatacagaattggcagaagagctgctacag
tggtttttgcaagaagaaaagagagagtgctttggagcttgtctctttacctgttatgat
ctgttaaggccagatgttgtcttggaaactgcgtggaggcacaatatcatggactttgcc
atgccctattttatccaggtcatgaaggaatacttgtccaaggtggataaactagatgcc
tccgaatctctgagaaaagaagaggaacaggctacagaaacgcaacctatcgtttatggt
cagccacagttgatgttgacagcagggcccagcgtggcagttcctccacaagcacctttt
ggctatggctacactgcacccccctatgggcagccacaacctggctttggatacagcatg
tga

DBGET integrated database retrieval system