KEGG   Shewanella sp. W3-18-1: Sputw3181_0013Help
Entry
Sputw3181_0013    CDS       T00453                                 

Definition
(GenBank) short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
shw  Shewanella sp. W3-18-1
Pathway
shw00071  Fatty acid degradation
shw00280  Valine, leucine and isoleucine degradation
shw00281  Geraniol degradation
shw00310  Lysine degradation
shw00362  Benzoate degradation
shw00380  Tryptophan metabolism
shw00410  beta-Alanine metabolism
shw00640  Propanoate metabolism
shw00650  Butanoate metabolism
shw00903  Limonene and pinene degradation
shw00930  Caprolactam degradation
shw01040  Biosynthesis of unsaturated fatty acids
shw01100  Metabolic pathways
shw01110  Biosynthesis of secondary metabolites
shw01120  Microbial metabolism in diverse environments
shw01130  Biosynthesis of antibiotics
shw01200  Carbon metabolism
shw01212  Fatty acid metabolism
Module
shw_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:shw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sputw3181_0013
   00650 Butanoate metabolism
    Sputw3181_0013
  Lipid metabolism
   00071 Fatty acid degradation
    Sputw3181_0013
   01040 Biosynthesis of unsaturated fatty acids
    Sputw3181_0013
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sputw3181_0013
   00310 Lysine degradation
    Sputw3181_0013
   00380 Tryptophan metabolism
    Sputw3181_0013
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sputw3181_0013
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sputw3181_0013
   00281 Geraniol degradation
    Sputw3181_0013
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sputw3181_0013
   00930 Caprolactam degradation
    Sputw3181_0013
Enzymes [BR:shw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sputw3181_0013
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sputw3181_0013
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sputw3181_0013
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Sputw3181_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABM22866
JGI: Sputw31810013
UniProt: A1RDW6
Position
complement(17097..19247)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDSIKQNSNIKALVLTSS
KDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFPTASAIKGFALGGGCET
ILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNALEWISTGNDQRAEDALK
VGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRNRKLSALTLPKLEAMMSFTTAKGMV
FAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLAKTDVAKALIGIFLNDQLVK
GKAKKAGKLAKEVKNAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALDLGLNEAAKLL
SAQVARGRSTPEKMAKVLNNITPSLDYAALKHSDVVVEAVVEHPKIKAQVLAEVEGYVSE
DAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKMPLVEVIRGEHSSEETIASVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEGGDFAAIDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMFENKRLGQKNGKGFYVYSVDSRGKP
KKDVDPTSYGLLKDAFGELKTFEADDIIARTMIPMIIETVRCLEEGIVASPAEADMGLVY
GLGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDAMRTKATNNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagtcctacaattcaagttgagttactcgaggataatattgccaagctg
tgctttaacgcacccggttcggtgaacaaattcgacagagaaaccctcgcttcgctcgat
gccgcattagacagcatcaagcaaaattccaatatcaaagcgttagtgctgacctccagt
aaagatacctttattgtgggtgccgacattaccgaatttttaggcctatttgcacaagat
gatgctgtactgctctcttgggttgaacaagccaacgctgtcttcaacaaactcgaagac
ttacctttcccaaccgcatctgcaatcaaaggctttgccttaggtggcggctgtgaaacc
attctggcaacggattttcgtatcgcagataccacagccaaaatcggtttacctgaaact
aaactcggcatcatcccaggctttggcggcacagttcgtctgccacgtgtaattggtgca
gataacgcacttgaatggatctccacaggtaacgaccaacgcgctgaagatgcactgaaa
gtcggtgctgtggatgctgtggttgcgccagaagcattagaagcggctgcgattcaaatg
ctcaaagatgctgttgcagaaaagctggattggcaagcgcgtcgtaaccgtaagctgtct
gccctaacgctgcccaaacttgaagctatgatgtcattcaccacagctaaaggcatggta
tttgctgttgcgggtaaacactacccagcaccaatggccgcagtaagcgtgattgagcaa
gcatcgactaaaggtcgtgctgaagcattacaaatcgaacatcaagcctttatcaagctg
gctaaaaccgacgttgctaaggcacttataggtatcttccttaatgatcaactcgttaaa
ggcaaagcgaaaaaagcgggtaagttagccaaagaagtgaaaaacgctgccgtattaggt
gctggcattatgggcggcggcatcgcctaccaaagcgccagcaaaggcacaccgattgtc
atgaaagacattgcccagccagcattagatttaggcctcaatgaagccgccaaactgcta
tcggcgcaagttgctcgtggccgttcaacgccagaaaaaatggccaaagtgctgaacaac
atcacgccttcattagattatgctgcgctcaaacacagtgatgtcgtcgttgaagccgtt
gttgaacatccaaaaattaaagcacaggttttagccgaagttgaaggttatgtgagtgaa
gatgcgattatcgcgtcaaacacctcaacgatttcaatcaacttgctcgctaagagcatg
aagaaacctgagcgtttctgcggtatgcatttcttcaacccagtgcacaaaatgccgttg
gtagaagttatccgtggcgagcacagctctgaagaaaccatcgcctctgttgtggcttac
gccagcaaaatgggcaaaaccccaatcgtggttaatgattgcccaggcttcttcgttaac
cgcgtactcttcccttactttgcaggctttaacggcctacttgccgaaggtggcgacttt
gctgcaatcgacaaagttatggaaaaacaatttggttggccaatgggcccagcttaccta
ctcgacgtagtgggtttagacacaggtcaccatgcccaagcagtaatggctgaaggtttc
cctgatcgtatgggtaaatctggtaccgacgcgattgatgtgatgtttgagaacaagcgc
cttggccagaaaaatggcaaaggtttctatgtctattcagttgatagccgtggcaaaccg
aagaaagatgtcgatcctacgagctacggcctattgaaagatgcctttggcgagttaaaa
acctttgaagccgatgacattattgcccgtactatgatccctatgatcatagaaaccgtg
cgctgtttagaagaaggcattgtcgcatcacctgccgaagcggatatgggcctggtttat
ggcttaggtttcccgccattcagaggaggcgtgttccgttacttggataccatgggtgtc
gcaaactttgtggccttagcagacaaatatgctcacttgggcggtctgtatcaagtcaca
gatgcgatgcgtacaaaagccaccaataatggtagctactaccaagcctaa

DBGET integrated database retrieval system