KEGG   Shewanella sp. W3-18-1: Sputw3181_0036Help
Entry
Sputw3181_0036    CDS       T00453                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
shw  Shewanella sp. W3-18-1
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:shw00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(46474..47457)
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWQTVVQDTLATADGVMLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELIFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKI
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKGFVRWLASKL
DTTLNGGEPNYVLAGQNYKPVPFKGNELTHSQTRYQAYRELYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
ACRNQALNYALDFFKRYATKNSNGKVV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcaactgaacacgatttaaatacctcagagcagcaa
gccttctggcaaaccgttgtccaagatacgctggccactgccgacggcgtcatgctggcc
tatatgatggtaaaacatccccaagcgcataccgcaattgttctcagcagtggtcgagtc
gagtcctatttaaagtatcaagaattgatcttcgacttataccaacagggttactctgtt
tatgccatagatcatcgtggccaagggctatcggatcgaatgacaatcaacccacatatg
ggacacgtgcgaagatttaatgattatatcgatgactttgctctatttatgcagaagata
gtgttaccacaaaacgacaaacaactcatgctactcggccattcaatgggtggcgcgatt
ggcactttgtatctcaaacagcatcccgatatttttactgcggcggcattttcggcgccc
atgtatggcattaaattacctatgcccaaagggttcgtgcgttggttagccagtaaactc
gataccacactcaatggcggcgagcctaattatgtgcttgcaggacaaaactataaacct
gttccattcaaagggaatgagctaactcacagccaaacccgataccaagcctaccgagaa
ttgtatgatgccgcgcctaagttacaactcggttcacccactaaccgttggttgactgaa
tctttagatgccgcagatacttgcgtactggcaacggcacaaattcgcactccgatactg
atactgcaagcgagtgaagataagattgttgataatgcggcccagaatctcgccgtgagt
acccattgccaattgaaagtaatcgctggggctgcccatgagatttttatggaaaaagac
gcctgccgaaaccaagccttaaactatgcactcgatttttttaaacgctacgcaacaaag
aattcgaatggaaaagttgtttaa

DBGET integrated database retrieval system